KEGG   Viruses: 1261950
Entry
1261950           CDS       T40000                                 

Gene name
stxA2, ST933Wp40
Definition
(RefSeq) Escherichia phage 933W; Shiga toxin Stx2c subunit A
  KO
K11006  shiga toxin subunit A
Taxonomy
TAX:10730
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Traversvirus; Escherichia virus 933W
Organism
vg  Viruses (Escherichia virus 933W)
SSDB
Motif
Pfam: RIP
Other DBs
NCBI-GeneID: 1261950
NCBI-ProteinID: NP_049500
RS: NC_000924
UniProt: P09385
LinkDB
Structure
PDB: 
2GA4

Position
NC_000924:21462..22421
AA seq 319 aa
MKCILFKWVLCLLLGFSSVSYSREFTIDFSTQQSYVSSLNSIRTEISTPLEHISQGTTSV
SVINHTPPGSYFAVDIRGLDVYQARFDHLRLIIEQNNLYVAGFVNTATNTFYRFSDFTHI
SVPGVTTVSMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTMTRDASRAV
LRFVTVTAEALRFRQIQREFRQALSETAPVYTMTPGDVDLTLNWGRISNVLPEYRGEDGV
RVGRISFNNISAILGTVAVILNCHHQGARSVRAVNEESQPECQITGDRPVIKINNTLWES
NTAAAFLNRKSQFLYTTGK
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaagtgtatattatttaaatgggtactgtgcctgttactgggtttttcttcggtatcc
tattcccgggagtttacgatagacttttcgacccaacaaagttatgtctcttcgttaaat
agtatacggacagagatatcgacccctcttgaacatatatctcaggggaccacatcggtg
tctgttattaaccacaccccaccgggcagttattttgctgtggatatacgagggcttgat
gtctatcaggcgcgttttgaccatcttcgtctgattattgagcaaaataatttatatgtg
gccgggttcgttaatacggcaacaaatactttctaccgtttttcagattttacacatata
tcagtgcccggtgtgacaacggtttccatgacaacggacagcagttataccactctgcaa
cgtgtcgcagcgctggaacgttccggaatgcaaatcagtcgtcactcactggtttcatca
tatctggcgttaatggagttcagtggtaatacaatgaccagagatgcatccagagcagtt
ctgcgttttgtcactgtcacagcagaagccttacgcttcaggcagatacagagagaattt
cgtcaggcactgtctgaaactgctcctgtgtatacgatgacgccgggagacgtggacctc
actctgaactgggggcgaatcagcaatgtgcttccggagtatcggggagaggatggtgtc
agagtggggagaatatcctttaataatatatcagcgatactggggactgtggccgttata
ctgaattgccatcatcagggggcgcgttctgttcgcgccgtgaatgaagagagtcaacca
gaatgtcagataactggcgacaggcctgttataaaaataaacaatacattatgggaaagt
aatacagctgcagcgtttctgaacagaaagtcacagtttttatatacaacgggtaaataa

DBGET integrated database retrieval system