KEGG   Viruses: 1262250
Entry
1262250           CDS       T40000                                 

Gene name
stx2B, VT2-Sap43
Definition
(RefSeq) Enterobacteria phage VT2-Sakai; Shiga toxin Stx2a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:97081
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Traversvirus; unclassified Traversvirus
Organism
vg  Viruses (Enterobacteria phage VT2-Sakai)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 1262250
NCBI-ProteinID: NP_050540
RS: NC_000902
UniProt: Q7AK26
LinkDB
Position
NC_000902:21924..22193
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system