KEGG   Viruses: 13828535
Entry
13828535          CDS       T40000                                 

Gene name
stx2B, D300_gp42
Definition
(RefSeq) Escherichia phage P13374; shiga toxin 2 subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Oslovirus; unclassified Oslovirus
Organism
vg  Viruses (Escherichia phage P13374)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 13828535
NCBI-ProteinID: YP_006906861
RS: NC_018846
UniProt: K0JCX5
LinkDB
Position
NC_018846:24905..25174
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system