KEGG   Viruses: 14536657Help
Entry
14536657          CDS       T40000                                 

Gene name
GP55, H486_gp041
Definition
(RefSeq) Caviid betaherpesvirus 2; GP55
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
TAX:33706
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae
Taxonomy
Organism
vg  Viruses (Caviid betaherpesvirus 2)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 ECF_trnsprt
Motif
Other DBs
NCBI-GeneID: 14536657
NCBI-ProteinID: YP_007417830
RS: NC_020231
UniProt: Q69024
LinkDB All DBs
Position
NC_020231:complement(94160..96865)
AA seq 901 aa AA seqDB search
MRPVRGIARSRILSCSWRGTWTSALTILYLGVYCESTTVTPTTVEDTTVSNGNHSDASRN
NTVIRNLTASVDFSQRKLYPYRICSMSMGTDLVRFARTIQCVPFNPRVNSEEGIMLIYKR
NILPYVFTAYTYQKELLFQRSYKYVTYDYLLGYSREFVALPMWEIFLVNSRGQCYTSHQR
VIGADRYIAYHNDNEVNETMWLMRDDMGNDDTYRYITVKEHARTPGSVWLYKETCSMNCI
VTKTKGKSKFPYDMFVLPSGVIVNISPFYNGSNGKTFREQREKFHIWSNYSILKDFGSRA
LEARIVPKMAFYEREDVVIGWEVNDQSNVTCEMILWETVDRAIRTEYENAFHYVARTLTS
TFVENKYSPDNNLTEDDIKCFKNDAQKKIEEVFLRDYNETYDMDGNATYHVTTGGLVIVW
QGLKQKSLKALEIAANESAVSATGSNSRRKRSLPDESTGDISYAQLQFAYDTLRTYINQA
LGHIAEAWCLDQKRTAEVLHELSKINPSNILSAIFGVPVAARVVGDVISLAKCIEVNQST
VLIKGDMRKFSDDGKLEGCYSRPVVWFSMKNSTEVRLGQLGEDNEILLGTHRMETCQTQD
YRIFVAGDIGYEFQQYVFTKKINLSEIDIIDTMIALKTEPLENIDFKVLELYSRDELAQA
NVFDLESIMREYNYQKKRLDFVVERVINPIPPALKGLDEMMNGMGAIGKGIGEAVGAVGG
AIGSFIGALVTFVTNPFGAFVVFLFCVGCITLVITVYRRQRRAMQRPFDYFFPYASQTIT
SSVADSSIAVAYPGPEGTSGDAPPPYPGEAPYGYKDLSVDADTRVSSSSAGAGADFNEED
AVRMLRAIKRLDDKKRQEIEKSSKDSASNKNSETRRRPGIMDRLRRRGGYQKLNTEDDVH
V
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgcgacccgtacgcggtatcgcgagatcgagaattctctcctgcagttggcgagggacg
tggacatcagctttgacgatcttgtacctcggtgtctactgtgagagtacgacggtcacc
cctactacggtcgaggacaccaccgtgtctaatggcaatcattcggacgcatcgcgtaac
aatactgtgataagaaatttgaccgcctcggtggattttagtcaacgaaaattatatccg
tatcggatatgttccatgtcaatgggaaccgatctggtcagatttgccaggactattcag
tgcgtacccttcaatccgagggtgaattcggaggaagggattatgttgatttacaagaga
aatattttgccatacgtctttacggcgtatacttatcagaaagagttgttgtttcaaagg
agttataaatatgtaacgtatgactacctgttgggttacagccgagagtttgttgcttta
ccgatgtgggagatttttttggtaaacagcagaggacaatgctacacttctcaccaacgc
gttattggcgctgatagatatatagcgtatcataacgataatgaagttaatgagaccatg
tggcttatgagggacgatatgggaaacgatgacacatatcggtacataacggtaaaagaa
cacgctcgcactccgggatctgtctggttgtataaggaaacatgtagcatgaattgtata
gttactaagactaaaggcaaatctaaatttccgtatgatatgttcgtcttgccgtccggt
gttatagtcaacatatctccattttacaacggctctaatgggaagacgttccgtgaacag
agagaaaaatttcacatttggagtaattatagcattttaaaggattttggatccagagct
ttagaagcgcgaatcgtaccgaagatggctttttacgagagagaagatgtagtaatcgga
tgggaagttaatgatcaatctaacgtgacgtgcgagatgattttatgggagactgtagat
agagccattcggaccgaatacgaaaatgcgtttcattatgtggcacgcacattgacctca
acgtttgtggagaacaaatacagtccagataataatttaaccgaagatgatatcaaatgt
ttcaagaacgatgcgcaaaagaagatagaagaggtttttcttcgtgattataatgagacg
tatgacatggatggaaatgcgacgtatcatgttacgaccggcggcttggtcatcgtgtgg
cagggtttgaagcaaaaatcgttaaaggcgttggagattgccgcgaatgaatctgcggtc
agcgctactggttctaatagccgtaggaaaagatcgttgcctgatgaatccactggtgac
ataagttatgcacaacttcagtttgcgtatgatactttgcggacatacatcaatcaggcc
ttgggtcatattgcagaggcgtggtgtttggatcagaagcgtaccgcggaagtactgcac
gaacttagtaagattaatccttctaatatcttatcggcgatattcggagtgcctgtggct
gctagagtggttggtgatgtgatatcgttagctaaatgcatcgaggtcaatcagtctact
gtgctcataaaaggtgatatgagaaaattttcggacgacggtaagcttgagggttgttat
tctagacccgtggtttggttctccatgaagaatagtacggaggtgcgactcggtcagctc
ggtgaggacaacgagatattactcggaacgcacaggatggagacgtgtcagacgcaggat
taccggatctttgtcgccggcgatataggatacgaatttcagcagtacgtgttcaccaag
aagatcaacctcagcgaaatagatattatcgatactatgatcgcattgaagaccgaaccg
ttggagaatatagatttcaaggtgctggagctatattcgagggacgagctggcgcaggcc
aacgtcttcgatctggagtccatcatgcgggaatacaattatcaaaagaagaggctcgac
ttcgtggttgaacgggtcatcaatcctataccgccggcgttgaagggtctggacgagatg
atgaacggtatgggcgctatcggtaaaggcataggcgaggccgtgggtgccgtcggaggc
gccataggctcgttcattggggccctggtgaccttcgttaccaatccgtttggagccttc
gtggtgttcctgttctgcgtcggttgtatcacgttggtgatcaccgtgtatcgtcgccag
aggagagctatgcaacgtcctttcgactacttctttccgtacgcctcccagaccatcacc
agctccgtggccgacagctccatagcagtggcctatccaggtcccgagggaacgtccggt
gacgctccacctccctatcccggcgaggcgccctatggatataaggatctgtccgtggat
gcggacactcgagtgtcgtcctcgtctgccggcgccggggcggacttcaacgaagaggac
gccgtgcggatgctacgtgctattaagcggttggatgacaaaaaacgtcaggagatagaa
aaatcttctaaggatagcgcgtcaaataaaaatagtgaaacccgacggagaccgggtata
atggacagactaagaaggagaggaggttatcaaaaattgaacacggaagacgacgtgcat
gtttaa

DBGET integrated database retrieval system