KEGG   Viruses: 14536673
Entry
14536673          CDS       T40000                                 

Gene name
GP80, H486_gp057
Definition
(RefSeq) Caviid betaherpesvirus 2; GP80
  KO
K21078  Betaherpesvirinae capsid scaffolding protein [EC:3.4.21.97]
Taxonomy
TAX:33706
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae
Organism
vg  Viruses (Caviid betaherpesvirus 2)
SSDB
Motif
Pfam: Peptidase_S21
Other DBs
NCBI-GeneID: 14536673
NCBI-ProteinID: YP_007417846
RS: NC_020231
UniProt: B7TPY6
LinkDB
Position
NC_020231:126926..129235
AA seq 769 aa
METDRVFVSGFLALYGEQPQEDCLRLSRDVVAANLPGVDPSSIAININHDDNAVVGRLHG
LFDLPNGLFCFGEISSPSFLDIVRRSAEKSQLVSRGPGNGLKPDAVVEYLSTGYPGLSLS
SRSTDERRCDAPSGPARAHIDGETTDEGTFFRHVAICGVGRRRGTLAIYGRDPGWMLDRF
PGISNEDKLRMVTRVVSAVFAPGARTGADARDPFRSDPYGLLANSVDTSYIRERFPKLDY
DKRVLRIPPDTYVKASESPTASRAEGDCIIKRSEPFLVWERRAEESGPSCGAAETDMSAQ
PQVVPTVVPAASAPAVPAAAVVSASPAPLALSSDCVYLPKDTFLSLVNASRREATFPDVG
RPKDADGAAALTSLPSFVAQTAPVQRFVLPESVTSTTRLQPAPYGYAGMEGGLGRPSQIA
SFQTPYDTSQYGGPAGSGYFGPLPGPSPQVLAPISQASPASQVHPAVVPHHVPSAAPPYQ
FPSAVPAAAPGTLHPGGTYPQFYPQPTYYGHRGYYGASPPPPPPLAGERYGPYDPRWPAD
ATDPYSRYPRDPVASREREHVGRKRRAEADDGDDQQVAREDLSLPGDADYPRSKRPAVEA
RDVRQSGRAREDPEYAELRNVIHDLRRDIAVIRSLSGSRSDANGSPAPVQSSSSPSSAPP
TVGDEEDASVPSAATTGVPAVIPTAHGLPVTTAPSAPAQPTDVARKAGKAGLPVSGGQHH
AHQPVRAKPPLVVNASCVPEAQPGTSRDAQMSILDINRQRFVDALRKME
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggagaccgacagggttttcgtgagcggtttccttgcgctgtacggggagcagccgcag
gaggactgtctccggctatcccgagacgtggtcgccgcgaatctacccggcgtggatccg
tcctcgatagcgatcaacatcaatcacgacgacaacgccgtggtcggtcgcctgcacggc
ctgttcgatctaccgaacgggctgttctgtttcggggagatcagctccccgtctttcctg
gatatcgtgcgacgcagcgccgagaagtcgcagctggtgtctcggggtccggggaacggg
ctgaagcccgacgccgtcgtggagtacctcagcacggggtaccccggcctctccctgtcc
agccgttccaccgacgagcgccgctgtgacgcgccgtccgggcccgcgcgcgctcatata
gacggcgagacgacggacgagggtacgtttttcaggcacgtcgccatatgcggcgtcggt
cggaggcgaggcacgctggcgatctacggtcgggaccccgggtggatgctggacaggttt
cccggcatctcgaacgaggacaaactccggatggtcacccgggtcgtctccgccgtcttc
gctccgggcgcgaggacgggcgcggacgcgcgggatccgttccgttccgatccgtacggc
ctgctggccaattccgtggatacatcgtacattcgcgagaggttcccgaaactggattac
gataagagggtcttgcggatacctcccgacacgtacgtgaaggccagcgagagtccgacg
gcgtctcgggccgaaggcgactgtattattaaaaggagtgagccttttctcgtctgggaa
cgtcgcgccgaggagagcggcccgtcgtgcggcgcggccgagaccgacatgtccgctcag
ccgcaggtcgttcccacagtcgtcccggccgcctccgcgcccgccgtgcccgccgccgcc
gtcgtctcggcctcgcctgcgccgctcgccctgtctagcgattgcgtctatcttcccaag
gatacgttcctgtcgctggtgaacgcgtccaggcgagaggcgacgtttcccgacgtcggc
aggccgaaagacgcggacggtgcggccgccctgacttcgctgccctcgttcgtggctcag
accgcacccgtccaacgcttcgtcctgcccgagtcggtcacgtcgacgacgcgtctgcag
ccggcgccgtacgggtacgcgggcatggagggcggtctcggtcgtccgtctcagatcgcc
tcgtttcagactccgtacgatacgtctcagtacggcgggcccgcggggtccggctacttc
ggacccctgccgggaccgtcgccgcaggtcctcgcgcccatttcccaggcgtcgcccgcg
tcccaggtccatccggccgtcgtgccgcatcacgtaccgtcggccgctccgccgtatcag
ttcccgagcgcggtgcccgccgcggcgccgggcactcttcatcctggcggtacgtatccg
cagttctatccgcagccgacgtattacggtcatcgggggtactacggagcgtcgccgccg
ccaccgccgccgttggccggagagcgttacgggccctacgatcctcgctggcccgcggac
gcgacggatccttattccagataccctcgggatcccgtcgcgagtagggagcgggagcac
gtcgggcgaaagaggcgcgcggaggcggacgacggggacgaccagcaagtcgccagagag
gatctcagtctgcccggtgacgccgactatccccgctccaagaggcccgccgtcgaggct
cgagacgtgcggcagtccggacgcgcgcgcgaggacccggagtacgcggaactcaggaac
gtgatacacgacctcaggagggacatcgcggtcatacgcagcctgagcggctcgcgttcc
gacgccaacggttctcccgccccggtgcagtcgtcgtcttctccgtcctcggcgcccccg
acggtcggggacgaggaagacgcctcggtcccgagcgccgcgacgaccggcgtcccggcg
gtcatccccaccgcacacggtctgcccgtcacgacggccccgtcggcgcccgcgcagccg
acagacgtcgcgcggaaggcgggcaaggccggactccccgtctccggaggtcagcaccac
gctcatcagcccgtcagggcgaaacctcccctggtggtgaacgcctcgtgcgtccccgag
gcgcagcccggcacgtcccgagacgcccagatgtccattctggacattaaccgacaacgt
ttcgtggacgctctgcggaagatggaatga

DBGET integrated database retrieval system