KEGG   Viruses: 1481748
Entry
1481748           CDS       T40000                                 

Gene name
stx1B, Stx1_p143
Definition
(RefSeq) Escherichia Stx1 converting phage; Shiga toxin Stx1a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:194948
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Traversvirus; unclassified Traversvirus
Organism
vg  Viruses (Escherichia Stx1 converting phage)
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-GeneID: 1481748
NCBI-ProteinID: NP_859222
RS: NC_004913
UniProt: Q776E7
LinkDB
Position
NC_004913:52276..52545
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system