KEGG   Viruses: 1481768
Entry
1481768           CDS       T40000                                 

Gene name
stx2B, Stx2II_p144
Definition
(RefSeq) Escherichia phage Stx2 II; Shiga toxin Stx2a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:194949
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Traversvirus; Escherichia virus Stx2 II
Organism
vg  Viruses (Escherichia virus Stx2 II)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 1481768
NCBI-ProteinID: NP_859391
RS: NC_004914
UniProt: Q776E0
LinkDB
Position
NC_004914:53812..54081
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system