KEGG   Viruses: 1486409
Entry
1486409           CDS       T40000                                 

Gene name
E3L, VARVgp044
Definition
(RefSeq) Variola virus; double-strand RNA-binding protein
  KO
K12969  Vaccinia virus protein E3
Taxonomy
TAX:10255 [GN:T40082]
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Variola virus)
SSDB
Motif
Pfam: z-alpha dsrm RPA_C RNA_pol_Rpc34
Other DBs
NCBI-GeneID: 1486409
NCBI-ProteinID: NP_042088
RS: NC_001611
UniProt: P33863
LinkDB
Position
NC_001611:complement(38632..39204)
AA seq 190 aa
MSKIYIDERSDAEIVCEAIKNIGLEGVTAVQLTRQLNMEKREVNKALYDLQRSAMVYSSD
DIPPRWFMTTEADKPDAMTMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKNANPVT
IINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVD
KLLGYVIIRF
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtctaagatctatattgacgagcgttctgacgcagagattgtatgtgaggctattaaa
aacattggacttgaaggagttactgctgtacaactaactagacaacttaatatggagaag
cgagaagttaataaagctctgtacgatcttcaacgtagtgctatggtgtacagctccgac
gatattcctcctcgttggtttatgacaactgaggcggataagccggatgctatgactatg
gctgacgtcataatagatgatgtatcccgcgaaaaatcaatgagagaggatcataagtct
tttgatgatgttattccggctaaaaaaattattgattggaaaaatgctaaccctgtcacc
attattaatgagtactgccaaataactaagagagattggtcttttcgtattgaatcagtg
gggcctagtaactctcctacattttatgcctgtgtagacatcgacgggagagtattcgat
aaggccgatggaaaatctaaacgagatgctaaaaataatgcagctaaattggctgtagat
aaacttcttggttacgtcatcattagattctga

DBGET integrated database retrieval system