KEGG   Viruses: 1487325
Entry
1487325           CDS       T40000                                 

Gene name
UL39, HHV2p36
Definition
(RefSeq) Human alphaherpesvirus 2; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:10310 [GN:T40074]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Human alphaherpesvirus 2)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN
Other DBs
NCBI-GeneID: 1487325
NCBI-ProteinID: YP_009137191
RS: NC_001798
UniProt: P89462 G9I261
LinkDB
Position
NC_001798:87060..90488
AA seq 1142 aa
MANRPAASALAGARSPSERQEPREPEVAPPGGDHVFCRKVSGVMVLSSDPPGPAAYRISD
SSFVQCGSNCSMIIDGDVARGHLRDLEGATSTGAFVAISNVAAGGDGRTAVVALGGTSGP
SATTSVGTQTSGEFLHGNPRTPEPQGPQAVPPPPPPPFPWGHECCARRDARGGAEKDVGA
AESWSDGPSSDSETEDSDSSDEDTGSETLSRSSSIWAAGATDDDDSDSDSRSDDSVQPDV
VVRRRWSDGPAPVAFPKPRRPGDSPGNPGLGAGTGPGSATDPRASADSDSAAHAAAPQAD
VAPVLDSQPTVGTDPGYPVPLELTPENAEAVARFLGDAVDREPALMLEYFCRCAREESKR
VPPRTFGSAPRLTEDDFGLLNYALAEMRRLCLDLPPVPPNAYTPYHLREYATRLVNGFKP
LVRRSARLYRILGVLVHLRIRTREASFEEWMRSKEVDLDFGLTERLREHEAQLMILAQAL
NPYDCLIHSTPNTLVERGLQSALKYEEFYLKRFGGHYMESVFQMYTRIAGFLACRATRGM
RHIALGRQGSWWEMFKFFFHRLYDHQIVPSTPAMLNLGTRNYYTSSCYLVNPQATTNQAT
LRAITGNVSAILARNGGIGLCMQAFNDASPGTASIMPALKVLDSLVAAHNKQSTRPTGAC
VYLEPWHSDVRAVLRMKGVLAGEEAQRCDNIFSALWMPDLFFKRLIRHLDGEKNVTWSLF
DRDTSMSLADFHGEEFEKLYEHLEAMGFGETIPIQDLAYAIVRSAATTGSPFIMFKDAVN
RHYIYDTQGAAIAGSNLCTEIVHPASKRSSGVCNLGSVNLARCVSRQTFDFGRLRDAVQA
CVLMVNIMIDSTLQPTPQCTRGNDNLRSMGIGMQGLHTACLKMGLDLESAEFRDLNTHIA
EVMLLAAMKTSNALCVRGARPFSHFKRSMYRAGRFHWERFSNASPRYEGEWEMLRQSMMK
HGLRNSQFIALMPTAASAQISDVSEGFAPLFTNLFSKVTRDGETLRPNTLLLKELERTFG
GKRLLDAMDGLEAKQWSVAQALPCLDPAHPLRRFKTAFDYDQELLIDLCADRAPYVDHSQ
SMTLYVTEKADGTLPASTLVRLLVHAYKRGLKTGMYYCKVRKATNSGVFAGDDNIVCTSC
AL
NT seq 3429 nt   +upstreamnt  +downstreamnt
atggccaaccgccctgccgcatccgccctcgccggagcgcggtctccgtccgaacgacag
gaaccccgggagcccgaggtcgccccccctggcggcgaccacgtgttttgcaggaaagtc
agcggcgtgatggtgctttccagcgatccccccggccccgcggcctaccgcattagcgac
agcagctttgttcaatgcggctccaactgcagtatgataatcgacggagacgtggcgcgc
ggtcatttgcgtgacctcgagggcgctacgtccaccggcgccttcgtcgcgatctcaaac
gtcgcagccggcggggatggccgaaccgccgtcgtggcgctcggcggaacctcgggcccg
tccgcgactacatccgtggggacccagacgtccggggagttcctccacgggaacccaagg
acccccgaaccccaaggaccccaggctgtccccccgccccctcctcccccctttccatgg
ggccacgagtgctgcgcccgtcgcgatgccaggggcggcgccgagaaggacgtcggggcc
gcggagtcatggtcagacggcccgtcgtccgactccgaaacggaggactcggactcctcg
gacgaggatacgggttcggagacgctgtctcgatcctcttcgatctgggccgcaggggcg
actgacgacgatgacagcgactccgactcgcggtcggacgactccgtgcagcccgacgtt
gtcgttcgtcgcagatggagcgacggccccgcccccgtggcctttcccaagccccggcgc
cccggcgactcccccggaaaccccggcctgggcgccggcaccgggccgggctccgcgacg
gacccgcgcgcgtcggccgactccgattccgcggcccacgccgccgcaccccaggcggac
gtggcgccggttctggacagccagcccactgtgggaacggaccccggctacccagtcccc
ctagaactcacgcccgagaacgcggaggcggtggcgcggtttctgggggacgccgtcgac
cgcgagcccgcgctcatgctggagtacttctgtcggtgcgcccgcgaggagagcaagcgc
gtgcccccacgaaccttcggcagcgccccccgcctcacggaggacgactttgggctcctg
aactacgcgctcgctgagatgcgacgcctgtgcctggaccttcccccggtcccccccaac
gcatacacgccctatcatctgagggagtatgcgacgcggctggttaacgggttcaaaccc
ctggtgcggcggtccgcccgcctgtatcgcatcctgggggttctggtccacctgcgcatc
cgtacccgggaggcctcctttgaggaatggatgcgctccaaggaggtggacctggacttc
gggctgacggaaaggcttcgcgaacacgaggcccagctaatgatcctggcccaggccctg
aacccctacgactgtctgatccacagcaccccgaacacgctcgtcgagcgggggctgcag
tcggcgctgaagtacgaagagttttacctcaagcgcttcggcgggcactacatggagtcc
gtcttccagatgtacacccgcatcgccgggtttctggcgtgccgggcgacccgcggcatg
cgccacatcgccctggggcgacaggggtcgtggtgggaaatgttcaagttctttttccac
cgcctctacgaccaccagatcgtgccgtccacccccgccatgctgaacctcggaacccgc
aactactacacgtccagctgctacctggtaaacccccaggccaccactaaccaggccacc
ctccgggccatcaccggcaacgtgagcgccatcctcgcccgcaacgggggcatcgggctg
tgcatgcaggcgttcaacgacgccagccccggcaccgccagcatcatgccggccctgaag
gtcctcgactccctggtggcggcgcacaacaaacagagcacgcgccccaccggggcgtgc
gtgtacctggaaccctggcacagcgacgttcgggccgtgctcagaatgaagggcgtcctc
gccggcgaggaggcccagcgctgcgacaacatcttcagcgccctctggatgccggacctg
ttcttcaagcgcctgatccgccacctcgacggcgagaaaaacgtcacctggtccctgttc
gaccgggacaccagcatgtcgctcgccgactttcacggcgaggagttcgagaagctgtac
gagcacctcgaggccatggggttcggcgaaacgatccccatccaggacctggcgtacgcc
atcgtgcgcagcgcggccaccaccggaagccccttcatcatgtttaaggacgcggtaaac
cgccactacatctacgacacgcaaggggcggccatcgccggctccaacctctgcaccgag
atcgtccacccggcctccaagcgatccagtggggtctgcaacctgggaagcgtgaatctg
gcccgatgcgtctccaggcagacgtttgactttgggcggctccgcgacgccgtgcaggcg
tgcgtgctgatggtgaacatcatgatcgacagcacgctacaacccacgccccagtgcacc
cgcggcaacgacaacctgcggtccatgggcattggcatgcagggcctgcacacggcgtgc
ctgaagatgggcctggatctggagtcggccgagttccgggacctgaacacacacatcgcc
gaggtgatgctgctcgcggccatgaagaccagtaacgcgctgtgcgttcgcggggcgcgt
cccttcagccactttaagcgcagcatgtaccgggccggccgctttcactgggagcgcttt
tcgaacgccagcccgcggtacgagggcgagtgggagatgctacgccagagcatgatgaaa
cacggcctgcgcaacagccagttcatcgcgctcatgcccaccgccgcctcggcccagatc
tcggacgtcagcgagggctttgcccccctgttcaccaacctgttcagcaaggtgaccagg
gacggcgagacgctgcgccccaacacgctcttgctgaaggaactcgagcgcacgttcggc
gggaagcggctcctggacgcgatggacgggctcgaggccaagcagtggtctgtggcccag
gccctgccttgcctggaccccgcccaccccctccggcggttcaagacggccttcgactac
gaccaggaactgctgatcgacctgtgtgcagaccgcgccccctatgttgatcacagccaa
tccatgactctgtatgtcacagagaaggcggacgggacgctccccgcctccaccctggtc
cgccttctcgtccacgcatataagcgcggcctgaagacggggatgtactactgcaaggtt
cgcaaggcgaccaacagcggggtgttcgccggcgacgacaacatcgtctgcacaagctgc
gcgctgtaa

DBGET integrated database retrieval system