KEGG   Viruses: 1487434
Entry
1487434           CDS       T40000                                 

Gene name
UL39, CeHV1gp41
Definition
(RefSeq) Macacine alphaherpesvirus 1; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:10325 [GN:T40077]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Macacine alphaherpesvirus 1)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN TetR_C_36
Other DBs
NCBI-GeneID: 1487434
NCBI-ProteinID: NP_851899
RS: NC_004812
UniProt: Q7T5D7
LinkDB
Position
NC_004812:86392..89385
AA seq 997 aa
MAEFRDLDNAPDNELPPTAIRHPRRFLYCDRASGVTVTTDGTSSCRITNSRFVQCGSHCA
MVVDGAAAGPREAAGGTAIAMTSTDSDAAVVAFVTPPARGGAMVSIATQTDPSPPEPPAT
DPPSASDSGENAPAAPPLSEERPDDDGDQRRADPVVEQFWDADGEPPRPPSTFPVPLELN
HKNAAAMARFLGDAGKRDPSLLLNYFCRCAREKEERRAKPQTFAAECELGYREIGYREFG
LLRYAIYELQRMFVDVPPMSHKVWTSVAFVDYVTQLVNKFKPLVRRSDRLYRLLGMLVHL
RIRARSVSFEAWMRCREVGLDDELVEQLRAHESQLVPFFEGLERGPTMRLMERGLQSALK
YEEFYLKSIDAWALESVPQMYTRIAGHLACHSDLAGRVVFGRDSSWLEMFTYFFTRFYGH
EIVPSTPAMLGLGTRRPYMSSCYLVNPQTTTTHSTLAAITQNVGPILARSGGIGLCLQEF
NDARRGNASIMPTLKALDSLVAAYNNQSLRPTGVTVYLEPWHSDIMAVLRMKGVLAGEES
RRCDNIFSALWMPDLFFKRLIRYLEGEKNVVWTLFTRRAGLSLSRFHGEEFETLYVRQEE
NGFGQAMPIQDLAYAIVRAAATTGSPFVMFKDAVNRHYIYDTQGSAIAGSNLCTEIVHPA
NATQSGVCNLASVNLAECVVGRTFDFNRLRDAVRACVLMVNIMIDRTAQPTPQCRRGHDR
LRSMGIGMQGLHTACLKMGLDLASEEFRELNRHIAEVMLLAAMQTSNALCFHGARPFHEF
KHSMFSAGRFHWEGFPDARPRYEGEWERLRQSMMKHGLRNSQFIALMPTVASAQIADVSE
GFAPLFTNMFSKVTRDGETLRPNTLLLQELRETFSGRRLNEVIDGLDAKQWSVEQALPCL
AADHPLRRFKTAFEYDQELLIDLCADRAPYVDHSQSLTLYVTERADGTLPASVLVRLLVH
AYKRGLKTGMYYCKVRKATNSGVFGGDDNIVCTSCVL
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggccgagttccgcgatctcgacaacgccccggacaacgagttgccccccaccgcgatc
cgccacccccggcggtttctgtactgcgaccgggccagcggggtgacggtgacgaccgac
ggaacctcgtcctgtcgcatcaccaacagccgcttcgtgcagtgtggctcgcactgcgcc
atggtcgttgacggagccgctgcgggcccccgggaagcggccggtgggaccgcgattgcc
atgacgagcacagattccgacgcggcggtcgtcgcctttgtcaccccacccgcccgcggc
ggggccatggtgtcgatcgcaacgcagaccgacccgtctccaccagagcccccggccaca
gaccccccctcggcctccgattccggagagaacgccccggccgcacccccgctatcggag
gagcggccggacgacgacggcgaccagcgccgggccgacccggtcgtcgagcagttctgg
gacgcggacggcgaaccccctcggcccccgtcgacgtttcccgtcccgctggagctcaac
cacaaaaacgcggccgccatggctcggttcctgggcgacgccggcaagcgcgaccccagc
ctgctgctgaactacttctgtcggtgcgcccgcgaaaaagaggagcggcgcgccaaaccg
cagaccttcgccgccgagtgcgagctcggctaccgcgagatcggctaccgcgagttcggg
ctgctgcggtacgcgatctacgaactgcagcgcatgttcgtggacgtgccgcccatgtcc
cacaaggtgtggacctccgtcgccttcgtggattacgtgacgcagctggtgaacaagttc
aagccgctggtgcggcgctccgaccgcctgtaccggctactggggatgctggtccacctc
cgcattcgggcccgctcggtttccttcgaggcctggatgcggtgcagggaggtagggctc
gacgatgagctggtggagcagctgcgcgcccacgagagtcagctggtacccttctttgag
ggcctggagcgcggcccgacgatgcggctcatggagcgcgggctgcagtcggccctgaag
tacgaggagttctacctgaagagcatcgacgcgtgggccctggagtccgtgccccagatg
tacacccgcattgccggacacctggcgtgccactcggacctcgccggccgggtcgtcttc
ggccgcgacagctcgtggctggagatgttcacgtactttttcacccgcttctacggccac
gagatcgtgccctcgacgcccgccatgctgggcctggggacccgccggccctacatgagc
agctgctacctggtgaacccgcagaccaccacgacccactcgaccctcgcggccatcacc
cagaacgtcggccccatcctggcccgcagcggcggcatcgggctgtgcctgcaggagttt
aacgacgcccgccgggggaacgccagcatcatgcccaccctcaaggccctggactcgctc
gtggccgcctacaacaaccagagcctgcggcccacgggcgtgaccgtgtacctggagccc
tggcacagcgacatcatggccgtgctgcggatgaagggcgtgctggcgggcgaggagtcg
cggcgctgcgacaacatcttcagcgccctgtggatgccggacctgttcttcaagcgcctc
atccgctacctggagggcgagaagaacgtcgtctggaccctgttcacccggagggccggc
ctgtccctgtcccgcttccacggggaggagtttgaaacgctgtacgtgcgccaggaggag
aacgggttcggccaggcgatgcccatccaggacctggcctacgccatcgtgcgcgccgcg
gccaccaccgggagccccttcgtgatgttcaaggacgccgtgaaccgccactacatctac
gacacccaggggtcggccatcgcgggctccaacctctgcacggagatcgtccaccccgcc
aacgcgacccagagcggggtgtgcaacctggccagcgtcaacctggcggagtgcgtcgtc
ggccggacgttcgacttcaaccggcttcgcgacgccgtgcgggcgtgcgtcctgatggtc
aacatcatgatcgaccgcacggcccagcccaccccccagtgccgccggggccacgaccgc
ctgaggtccatgggcatcggcatgcaggggctgcatacggcctgcctcaagatggggctc
gacctggcctccgaggagttccgggagctgaaccgccacatcgccgaggtgatgctgctg
gcggcgatgcagaccagcaacgccctgtgctttcacggggcgcgcccgttccacgagttc
aagcacagcatgttcagcgccggccgcttccactgggagggctttccggacgcgcgcccc
cggtacgagggcgagtgggagaggctgcgccagagcatgatgaagcacgggctgcgcaac
agccagttcatcgcgctgatgcccaccgtcgcctcggcgcagatcgccgacgtcagcgag
gggttcgcgcccctcttcaccaacatgttcagcaaggtcacgcgcgacggcgagacgctg
cgccccaacacgctgctgctgcaggagctccgggagacgttctccggccggcggctgaat
gaggtcatcgatgggctcgatgccaagcagtggtcggtggagcaggcgctgccgtgcctg
gccgcggaccacccgcttcggcgattcaagacggccttcgagtacgaccaggagctgctg
atcgacctctgcgccgaccgcgccccgtacgtggaccacagccaatcgctgacgctgtac
gtcacggagagggcggacggcaccctccccgcctccgtcctggtgcgcctcctcgtccac
gcatataagcggggcctgaagacgggcatgtactactgcaaggtccgcaaggcgaccaac
agcggggtcttcggcggggacgacaacatcgtctgcaccagctgcgttctgtga

DBGET integrated database retrieval system