KEGG   Viruses: 1490008Help
Entry
1490008           CDS       T40000                                 

Gene name
nef, SIVgp7
Definition
(RefSeq) Simian immunodeficiency virus; nef protein
  KO
K22891  HIV-1 protein Nef
Taxonomy
TAX:11723
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Taxonomy
Organism
vg  Viruses (Simian immunodeficiency virus)
SSDB OrthologParalogGFIT
Motif
Pfam: F-protein
Motif
Other DBs
NCBI-GeneID: 1490008
NCBI-ProteinID: NP_054373
RS: NC_001549
UniProt: Q02840
LinkDB All DBs
Position
NC_001549:8600..9271
AA seq 223 aa AA seqDB search
MGSSNSKRQQQGLLKLWRGLRGKPGADWVLLSDPLIGQSSTVQEECGKALKKSWGKGKMT
PDGRRLQEGDTFDEWDDDEEEVGFPVQPRVPLRQMTYKLAVDFSHFLKSKGGLDGIYYSE
RREKILNLYALNEWGIIDDWQAYSPGPGIRYPRVFGFCFKLVPVDLHEEARNCERHCLMH
PAQMGEDPDGIDHGEVLVWKFDPKLAVEYRPDMFKDMHEHAKR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgggctccagcaactccaagaggcagcaacagggcttgctcaagctctggcgagggctg
cgagggaagcctggggcagactgggtgctattgtccgatccgcttatcgggcagtcatca
acagtccaagaagagtgcggcaaggccttgaaaaagtcctggggtaaaggtaaaatgact
ccagacggccgccgcctgcaagaaggagacacctttgatgagtgggatgatgatgaagaa
gaagtaggcttccctgtgcaacctcgagtccccttaagacagatgacctataaattagca
gtggacttttcccactttttaaaatcaaaggggggactggatgggatatattactctgaa
agaagagaaaagatcctgaatttgtatgccttgaacgagtggggaataatagatgattgg
caagcttactcaccaggcccggggataaggtacccgagagtctttggcttctgctttaag
ctagtcccagtggacctgcatgaggaggcacgcaactgtgagagacactgtctgatgcat
ccagcacagatgggggaagatcctgatggaatagatcatggagaagtcttggtctggaag
tttgacccgaagttggcggtggagtaccgcccggacatgtttaaggacatgcacgaacat
gcaaagcgctag

DBGET integrated database retrieval system