KEGG   Viruses: 155871Help
Entry
155871            CDS       T40000                                 

Gene name
tat, HIV1gp5
Definition
(RefSeq) Human immunodeficiency virus 1; Tat
  KO
K19258  HIV-1 protein Tat
Taxonomy
TAX:11676 [GN:T40001]
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Taxonomy
Organism
vg  Viruses (Human immunodeficiency virus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: Tat TP2
Motif
Other DBs
NCBI-GeneID: 155871
NCBI-ProteinID: NP_057853
RS: NC_001802
UniProt: P04608
LinkDB All DBs
Structure
PDB: 

Position
NC_001802:join(5377..5591,7925..7970)
AA seq 86 aa AA seqDB search
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQ
NSQTHQASLSKQPTSQPRGDPTGPKE
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggagccagtagatcctagactagagccctggaagcatccaggaagtcagcctaaaact
gcttgtaccaattgctattgtaaaaagtgttgctttcattgccaagtttgtttcataaca
aaagccttaggcatctcctatggcaggaagaagcggagacagcgacgaagagctcatcag
aacagtcagactcatcaagcttctctatcaaagcaacccacctcccaaccccgaggggac
ccgacaggcccgaaggaatag

DBGET integrated database retrieval system