KEGG   Viruses: 156110
Entry
156110            CDS       T40000                                 

Gene name
nef, HIV1gp9
Definition
(RefSeq) Human immunodeficiency virus 1; Nef
  KO
K22891  HIV-1 protein Nef
Taxonomy
TAX:11676 [GN:T40001]
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Organism
vg  Viruses (Human immunodeficiency virus 1)
SSDB
Motif
Pfam: F-protein Sigma70_r4
Other DBs
NCBI-GeneID: 156110
NCBI-ProteinID: NP_057857
RS: NC_001802
UniProt: P04601
LinkDB
Structure
PDB: 

Position
NC_001802:8343..8963
AA seq 206 aa
MGGKWSKSSVIGWPTVRERMRRAEPAADRVGAASRDLEKHGAITSSNTAATNAACAWLEA
QEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGY
FPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKIEEANKGENTSLLHPVSLHGMDDPEREV
LEWRFDSRLAFHHVARELHPEYFKNC
NT seq 621 nt   +upstreamnt  +downstreamnt
atgggtggcaagtggtcaaaaagtagtgtgattggatggcctactgtaagggaaagaatg
agacgagctgagccagcagcagatagggtgggagcagcatctcgagacctggaaaaacat
ggagcaatcacaagtagcaatacagcagctaccaatgctgcttgtgcctggctagaagca
caagaggaggaggaggtgggttttccagtcacacctcaggtacctttaagaccaatgact
tacaaggcagctgtagatcttagccactttttaaaagaaaaggggggactggaagggcta
attcactcccaaagaagacaagatatccttgatctgtggatctaccacacacaaggctac
ttccctgattagcagaactacacaccagggccaggggtcagatatccactgacctttgga
tggtgctacaagctagtaccagttgagccagataagatagaagaggccaataaaggagag
aacaccagcttgttacaccctgtgagcctgcatgggatggatgacccggagagagaagtg
ttagagtggaggtttgacagccgcctagcatttcatcacgtggcccgagagctgcatccg
gagtacttcaagaactgctga

DBGET integrated database retrieval system