KEGG   Viruses: 1724713
Entry
1724713           CDS       T40000                                 

Gene name
HIV2gp5
Definition
(RefSeq) Human immunodeficiency virus 2; tat protein
  KO
K19258  HIV-1 protein Tat
Taxonomy
TAX:11709 [GN:T40002]
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Organism
vg  Viruses (Human immunodeficiency virus 2)
SSDB
Motif
Pfam: Tat DUF4677
Other DBs
NCBI-GeneID: 1724713
NCBI-ProteinID: NP_056842
RS: NC_001722
UniProt: P18098
LinkDB
Position
NC_001722:join(6402..6697,8861..8957)
AA seq 130 aa
METPLKAPESSLKPYNEPSSCTSERDVTAQELAKQGEELLAQLHRPLEPCTNKCYCKRCS
FHCQLCFSKKGLGISYERKGRRRRTPRKTKTPSPSAPDKSISTRTGDSQPTKEQKKTSEA
TVVTTCGLGQ
NT seq 393 nt   +upstreamnt  +downstreamnt
atggagacacccttgaaggcgccagagagctcattaaaaccctacaacgagccctcttcg
tgcacttcagagcgggatgtaaccgctcaagaattggctaaacaaggagaagaactcctt
gcccagctgcaccgacccctagagccatgcactaacaaatgctattgtaagcgatgcagt
ttccattgccagctgtgtttctcgaaaaaggggctcggaatatcatatgagcgaaagggc
agacgaagaaggactccaaggaaaactaagactccttcgccttctgcaccagacaaatcc
atatccacaaggaccggggacagccagccaacgaaggaacagaagaagacgtcggaggcg
acagtggttacgacttgtggccttggccaataa

DBGET integrated database retrieval system