KEGG   Viruses: 1724715
Entry
1724715           CDS       T40000                                 

Gene name
HIV2gp8
Definition
(RefSeq) Human immunodeficiency virus 2; nef protein
  KO
K22891  HIV-1 protein Nef
Taxonomy
TAX:11709 [GN:T40002]
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Organism
vg  Viruses (Human immunodeficiency virus 2)
SSDB
Motif
Pfam: F-protein
Other DBs
NCBI-GeneID: 1724715
NCBI-ProteinID: NP_056845
RS: NC_001722
UniProt: P18092
LinkDB
Position
NC_001722:9120..9893
AA seq 257 aa
MGASGSKKLSKHSRGLRERLLRARGDGYGKQRDASGGEYSQFQEESGREQNSPSCEGQQY
QQGEYMNSPWRNPATERQKDLYRQQNMDDVDSDDDDLIGVPVTPRVPRREMTYKLAIDMS
HFIKEKGGLQGMFYSRRRHRILDIYLEKEEGIIPDWQNYTHGPGVRYPMYFGWLWKLVSV
ELSQEAEEDEANCLVHPAQTSRHDDEHGETLVWQFDSMLAYNYKAFTLYPEEFGHKSGLP
EKEWKAKLKARGIPYSE
NT seq 774 nt   +upstreamnt  +downstreamnt
atgggtgcgagtggatccaagaagctttccaagcattcgcgaggactacgagagagactc
ttgcgggcgcgtggggatggttatgggaagcagcgcgacgcatcgggaggggaatactcg
cagttccaagaagaatcaggcagggagcagaactcgccctcctgtgagggacagcagtat
cagcagggagagtacatgaacagcccatggagaaacccagcaacagaaagacagaaagat
ttgtataggcagcaaaatatggatgatgtagattctgatgatgatgacctaataggagtt
cctgttacaccaagagtaccacggagagaaatgacctataaattggcaatagatatgtca
cattttataaaagaaaaagggggactgcaagggatgttttacagtaggaggagacataga
atcctagacatatacctagaaaaagaggaagggataataccagattggcagaattatact
catgggccaggagtaaggtacccaatgtacttcgggtggctgtggaagctagtatcagta
gaactctcacaagaggcagaggaagatgaggccaactgcttagtacacccagcacaaaca
agcagacatgatgatgagcatggggagacattagtgtggcagtttgactccatgctggcc
tataactacaaggccttcactctgtacccagaagagtttgggcacaagtcaggattgcca
gagaaagaatggaaggcaaaactgaaagcaagagggataccatatagtgaataa

DBGET integrated database retrieval system