KEGG   Viruses: 18533931
Entry
18533931          CDS       T40000                                 

Gene name
UL39, CI09_gp42
Definition
(RefSeq) Chimpanzee herpesvirus strain 105640; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:332937
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus; Panine alphaherpesvirus 3
Organism
vg  Viruses (Panine alphaherpesvirus 3)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN
Other DBs
NCBI-GeneID: 18533931
NCBI-ProteinID: YP_009011026
RS: NC_023677
UniProt: K9MHC1
LinkDB
Position
NC_023677:86905..90354
AA seq 1149 aa
MANRPAASARAGARSPSERPETRHTEVAPPGGDQVFCRKVNGVMVLSNDPPGPATYRISD
SSFVQCGSNCSMIIDGDEARGHSRALGGSTSTGAFVAITNVGAGGDGRTAVVALGGTSGP
AATTSVGTQTSGEFLSGGQPGAPEPQGPQAGPPPPPPFPWGHDCCSRRDARGGTAGSGAE
KDVGAAESCSDGSSSDSETEDSDSSDEDTDSRAETLSRSSSIWAGGATDDDYSDCDSQSD
DSVQPDGVGRRRWSDGPAPMDFPKPRHPGDSPGTPGLGAGTGSGSATNPRASADSGSTAH
AAAPQADVAPLLDSQPTVGTGPAYPVPLELTPENAEAVARFLGDAVDREPTLMLEYFCRC
AREETKRTPPRTFGSAPRLTEDDFGLLNYALAEMRRLCLDLPPVPPNAYMPYYLREYATR
LVNGFKPLVRRSARLYRILGILVHLRIRTREASFEEWMRSKEVALDFGLTERLREHEAQL
MILAQALNHYDCLIHSTPNTLVERGLQSALKYEEFYLKRFGGHYMESVFQMYTRIAGFLA
CRATRGMRHIALGRRGSWWEMFKFFFHRLYDHQIVPSTPAMLNLGTRNYYTSSCYLVNPQ
ATTNQATLRAITSNVSAILARNGGIGLCVQAFNDAGPGTASIMPALKVLDSLVAAHNKQS
TRPTGACVYLEPWHTDVRAVLRMKGVLAGEEAQRCDNIFSALWMPDLFFKRLIRHLDGEK
NVTWSLFDRDTSMSLADFHGEEFEKLYEHLEAMGFGETIPIQELAYAIVRSAATTGSPFI
MFKDAVNRHYIYDTQGAAIAGSNLCTEIVHPSSKRSSGVCNLGSVNLARCVSRRTFDFGM
LRDAVQACVLMVNIMIDSTLQPTPQCARGHDNLRSMGIGMQGLHTACLKMGLDLESAEFR
DLNKHIAEVMLLSAMKTSNALCVRGARPFSHFKRSMYRAGRFHWERFSDARPRYEGEWEM
LRQSMMKHGLRNSQFIALMPTAASAQISDVSEGFAPLFTNLFSKVTRDGETLRPNTLLLK
ELERTFSGKRLLDAMDGLEANQWSVAQALPCLDPAHPLRRFKTAFDYDQELLIDLCADRA
PYVDHSQSMTLYVTEKADGTLPASTLVRLLVHAYKRGLKTGMYYCKVRKATNSGVFGGDD
NIVCTSCAL
NT seq 3450 nt   +upstreamnt  +downstreamnt
atggccaaccgccctgctgcgtccgctcgcgccggagcgcggtctccatccgaacgaccg
gaaacccggcacaccgaggttgctccccccggcggcgaccaggtgttttgcaggaaagtc
aacggcgtgatggtgctttccaacgatccccccggccccgcgacctaccgcattagcgac
agcagtttcgttcaatgtggctccaactgcagcatgataatcgacggagacgaggcgcgc
ggtcattcgcgtgccctcgggggctctacgtccaccggtgcctttgtcgcgatcacaaac
gtcggagccggcggggatggcagaaccgccgttgtggctctcggcggaacatcgggcccg
gccgcgactacgtccgtcgggacccaaacgtccggggagttcctctccgggggccagcct
ggggcccccgaaccccaagggccccaggctggccccccgcctcctcccccctttccgtgg
ggccacgattgctgctcccgtcgcgatgcccggggcggcaccgcgggctcaggcgccgag
aaggacgtcggggccgcggagtcatgttcagacggctcgtcatccgactccgaaacggag
gactcggactcatcggacgaggatacggactcgcgcgcggagacgctgtcccgatcctct
tcgatatgggccggaggggcgactgacgacgattacagcgactgcgactcgcagtcggac
gactccgtgcagcccgacggtgtcggtcgccgcagatggagcgacggccccgcccccatg
gacttccccaaaccccggcaccccggcgactcccctggaacccccggtctgggcgccggc
accgggtcgggctccgcgacgaacccgcgcgcgtcggccgactccggttccacggcccac
gccgccgcaccccaggccgatgtggcgccgcttctggacagccagcccactgtgggaacg
ggccctgcctacccagtccccctagaactcactcccgagaacgcggaggcggtggcgcgt
tttctgggggatgccgtagaccgcgagcccacgctcatgctggagtacttctgtcggtgc
gcccgcgaggagaccaagcgcacgcccccacgaacctttggcagcgccccccgcctcacg
gaggacgactttgggctcctgaactacgcgctcgctgagatgcgacgcctgtgtctggac
cttccccctgtcccccccaacgcatacatgccctattatctgagggagtatgcgacgcgg
ctcgtcaacgggttcaaacccctggtgcgtcggtccgcccgcctgtatcgcatcctgggg
attctggttcacctgcgcatccgtacccgggaggcctcctttgaggaatggatgcgctcc
aaggaggtggccctggacttcgggctaacggaaaggcttcgcgaacacgaggcccagctg
atgatcctggcccaggccctaaatcattacgactgtctgatccacagcaccccgaacact
ctcgtcgagcggggactgcagtcggcgctgaagtacgaagagttttacctaaagcgcttc
ggcgggcactacatggagtccgtcttccagatgtacacccgcattgccgggttcctggcg
tgccgggcgactcgcggcatgcgccacatcgccttggggcgacgggggtcgtggtgggaa
atgttcaagttctttttccaccgcctctacgaccaccagatcgtgccgtccacccccgcc
atgctgaacctcggaacccgcaactactacacgtccagctgctacctggtaaacccccag
gccactaccaaccaggccaccctacgggccatcaccagcaacgtcagcgccatcctcgcc
cgcaacgggggcatcgggctctgtgtgcaggcgtttaacgacgccggccccggcaccgcc
agcatcatgccggccctgaaggtcctcgactctctggtggcggcgcataacaaacagagc
acgcgccccaccggagcgtgcgtgtacctggaaccctggcacaccgacgttcgggccgtg
cttagaatgaagggcgtcctcgccggcgaggaggcccagcgctgcgacaacatcttcagc
gccctatggatgccggacctgttctttaagcgcctgatccgccacctcgacggcgagaaa
aacgtcacctggtccctgtttgatagggacaccagcatgtcgctcgccgactttcacggc
gaggagttcgagaagctgtacgagcacctcgaggccatggggttcggagagacgatcccc
atccaggaactggcgtacgccatcgtgcgcagcgcggccacaaccggaagccccttcatc
atgtttaaggacgcggtgaaccgccactacatctacgacacgcaaggggcggccattgcc
ggctccaacctctgcacagagatcgtccacccgtcctccaaacgctccagcggggtctgc
aacctgggaagcgtgaatttggcccgatgcgtctcccgccggacgttcgattttggcatg
ctccgcgacgccgtgcaggcgtgcgtgctgatggttaatatcatgatagacagcacgctg
cagccgacgccccagtgcgcccgcggccacgacaacctgcggtccatgggcatcggcatg
cagggcctgcacacggcgtgcctgaagatgggcctggatctggagtcggccgagttccgg
gacctgaacaaacacatcgccgaggtgatgctgctctcggccatgaagaccagtaacgcg
ctgtgtgttcgtggggcccgtcccttcagccactttaaacgcagcatgtaccgggccggc
cgctttcactgggagcgcttttcggacgcccgtccgcggtacgagggcgagtgggagatg
ctacgccagagcatgatgaaacacggcctgcgcaacagccagttcatcgcgctcatgccc
accgccgcctcggcccagatctcggacgtcagcgagggctttgcccccctgttcaccaac
ctgttcagcaaggtgaccagggacggcgagacgctgcgccccaacacgctgttgctgaag
gaactcgagcgcacgttcagcgggaagcggctcctggacgcgatggacgggctcgaagcc
aaccagtggtctgtggcccaggccctgccttgcctggaccccgcccatcccctccggcgg
ttcaagaccgcgttcgactacgaccaggaactgctgatcgacctgtgtgccgaccgcgcc
ccctatgttgatcacagccaatccatgactctgtatgtcacagagaaggcggacggaacg
ctccccgcctccaccctggtccgccttctcgtccacgcatataagcgcggactaaagacg
gggatgtactactgcaaggttcgcaaggcgaccaacagcggggttttcggcggggacgac
aacatcgtctgcacaagctgcgcgttgtaa

DBGET integrated database retrieval system