KEGG   Viruses: 19621683
Entry
19621683          CDS       T40000                                 

Gene name
UL39, GX49_gp41
Definition
(RefSeq) Fruit bat alphaherpesvirus 1; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus; unclassified Simplexvirus
Organism
vg  Viruses (Fruit bat alphaherpesvirus 1)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN
Other DBs
NCBI-GeneID: 19621683
NCBI-ProteinID: YP_009042101
RS: NC_024306
UniProt: A0A060PYA7
LinkDB
Position
NC_024306:82257..85988
AA seq 1243 aa
MASFPNASNNQRSARTFKRPRRMEPSAAGAGPSNPASGSGYFFFCDRASNVTVVPPVVPD
GMACHISNSHFIQCGSNCMMIVDGSASCPPVVYRPTPPVAQPFPPSSVTVTSRQHGENSR
TTAVVFTEHASGAGAISSAAPPSPPKLTKPANPPASPTPAYPSTTSLSSTTASSWTPLYS
RPRSGDSESSTESEWEDEDADTRPRGGADSEFYLDFSTKKWQPEPNQGKDAASHPNPEAP
MESAIKSESESEANTDSDSDSNSESESDAGATGETALAAGPTPTANPTSGCESESETETE
SLCDATLLSEDEFGSDEDFLVALPHPPDAGQCCSLSTSGPTSADDRQSSGNPPPAKPPRC
PESPLAQPPTCPEAAAAHSDAACQTTNPALDEEEARYEAVDIVIPSTPVLDALDIQFGMP
RRLKFPVPPDPTHENVTAVVKFLKLRRKYEPLVFLEYFYQCAHRVEETAGPQSFARQPFL
SRSEFGLLRYALSELQGLFMDVPQIPVNIHRPFAFSNYITTLVNKFKPLVRRSEKLYQIL
GLLVHLRIRTRAASFREWMQSPDVKLDAELVKQLHTHERRLLDFFEGLEYGPARRFMERG
LQSALKYEEFYLRPFGGYSLESVNQMYTRIAGFLACHATDCQQLIFGRPATWFELFLYFF
QYLYDHKIVPSTPAMLNLGRRNYYTSSCYLVNPQTTTNKATLDALTHNVKDILAQRGGVG
LCLQSFNDAHRKQASLMPALKVLDSLVAAYNHASRRPTGVCVYIEPWHSDIMSILRMKGV
LAGEEAQRCDNLFSALWMPDLFFKRLIRHLEGETGVLWTLFDKAESMALSDFHGQEFENL
YEVYEQMGLGNPMPIQDVAFAIVRSAATTGSPFIMFKDAVNRHYIYDTQGAAISGSNLCT
EIVHPADKDSSGVCNLGSVNLAACVVDGVFSFDQLRQAVQACVLMVNVMIDCASQPTIQC
RRGHDRFRSMGIGMQGLHTAALMLGLDMTSEAFRELNKHIAEVMLLAAMKTSNGLCRHGA
EPFAEFGKSMYRAGRFHWERFPDAKPRYEGEWDLLRQSMMRFGLRNSQFIALMPTVTSSQ
VSEVSEGFAPLFTNMFSKVTKEGELLRPNILLLRELRKTFGGKRLLDVLDKLDSTQWSVE
KALPCLAPNHPLRKFKTAFDYDQTLLIDLCADRAPYVDHSQSMTLYVSESANGTLPASTL
TRLLIHAYKRGLKTGMYYCKVRKATNSGVFGGDENLVCTSCVL
NT seq 3732 nt   +upstreamnt  +downstreamnt
atggccagcttccccaacgcttccaacaaccagcgctctgcgcgaacttttaagcgcccc
agacggatggagccttcggctgctggggctgggccatccaaccccgccagcggctctggg
tattttttcttctgtgatcgagcaagcaacgtcacagtggttccacccgttgttcccgac
ggcatggcttgtcacattagcaacagccactttattcaatgtggctctaactgcatgatg
attgtggacggcagcgcctcctgcccaccagttgtgtataggccgacgcccccggtggca
caaccttttcccccatcgtccgtcacagttaccagccgccaacatggggaaaactcgcgg
acaactgccgtcgtgtttaccgagcatgcctccggtgccggtgcaatttccagtgctgcg
ccaccttcgcctcccaaacttaccaaaccagccaacccccccgcttctccaaccccagcc
tatccatcaaccacctctctatcttccacaacggcttcgtcctggacccctttgtactcc
cgaccccgcagtggcgacagcgagtccagcaccgaaagcgagtgggaagacgaggacgcc
gacacccgcccgcgtggtggagccgattccgagttttacttggacttcagcaccaaaaaa
tggcagccagaaccaaaccagggtaaggatgccgcctcccaccccaatcccgaggctccc
atggagtcagcaattaagtctgagtctgagtccgaagccaacactgactcagactcagac
tcaaattcagaatcagagtccgacgcgggggccactggcgagacagctctggccgcgggg
ccaacgcccaccgctaaccccacttcaggatgtgagtcagagtccgaaacagaaaccgag
tctctctgcgacgccacccttctttcagaagacgaatttgggtctgacgaagactttttg
gtcgccctcccacaccccccagacgcaggccaatgttgcagtctcagcacttcaggtcct
acctcggccgacgaccgccagtcttccggaaaccccccaccagccaagcccccccgatgc
cccgagtcccctctcgcccaaccccccacctgcccggaggccgcggcggcccactccgat
gctgcctgccaaaccaccaaccctgcacttgacgaagaggaggcgaggtatgaagctgta
gacattgtcatcccgtcaacgccagtcttggatgctttggacattcaatttggaatgccc
cgccgcttgaagtttcccgtcccccccgacccaacgcacgagaatgtgacagcggttgtg
aaattcctaaaactgcgccgaaaatacgagcctctagttttcctagaatatttttaccag
tgtgcccaccgcgtagaagaaactgctggcccccagtcgtttgcgcggcagccctttctc
tcgcgcagcgaatttggcctgctgagatatgccctcagtgagctccaaggcctgtttatg
gacgtgcctcaaattcctgtcaacatccatcgcccctttgccttttcgaactacatcaca
accctcgtgaataagtttaagccgctcgtgcgccgctccgaaaagctataccagattttg
gggttgctcgtgcatttgcgcattcggacccgcgccgcttcatttcgcgagtggatgcag
tctccggatgtcaagctagatgcagaattggttaagcagctacacacacacgagcgccga
cttcttgatttttttgaggggttggagtacggccccgcgaggcgcttcatggagcgcggt
ttgcagtcagccctcaagtacgaagagttctatctgcggccgttcgggggttactcgctc
gagtctgtcaaccaaatgtacacgcgaattgcaggcttcttggcttgccatgccacggac
tgccagcaacttatctttggccgccccgccacatggtttgagctgtttttgtactttttc
caatacctttatgatcataaaattgtgccttctacccctgcaatgctcaacctgggtcgc
cgcaactactacacctccagctgctatttagttaaccctcagaccaccactaacaaagcc
accctcgacgccctcacacacaacgtgaaggatatcttggcccagcgcggtggagtcggg
ttgtgtctgcaatcgtttaacgatgcccaccgcaaacaagccagcttgatgccagccctg
aaggtgctggattccctcgttgctgcctacaaccacgccagcaggcgccctactggcgtg
tgtgtctacatcgagccttggcattcagacatcatgtcgattctccgcatgaaaggcgtg
ctggcgggcgaagaagcgcagcgctgtgataacctgtttagcgctctctggatgcccgat
ttgttttttaagcgcctcatccgccacctcgaaggtgagacgggcgtgctgtggaccctg
tttgacaaggctgagagcatggcgctctccgacttccacggccaggagtttgagaacctg
tacgaggtttatgagcagatgggcctgggaaaccccatgcccattcaggatgttgccttc
gcgattgtccgcagcgcggccaccaccgggagccccttcatcatgttcaaagacgcggtt
aaccgccactacatttacgacacccaaggtgcggccatctccggatccaacctttgcacc
gaaatagtgcaccccgccgacaaagactcaagcggggtctgcaacttaggcagcgtaaac
ctggctgcgtgtgtggtggacggtgtttttagctttgatcaactgcgacaggctgtgcag
gcgtgcgtcctcatggtaaacgttatgattgactgcgcgtcccaacccactattcagtgc
cgccgaggccatgaccgctttcgctccatgggcatcggcatgcaaggcttgcataccgct
gcgctgatgctggggttggacatgacctcggaagcgtttcgggagctgaacaaacacatc
gcagaagtgatgcttctggcagccatgaaaactagcaacgggctgtgtcggcatggcgcc
gaacccttcgccgagtttggaaaaagcatgtatcgcgccggtcgctttcactgggagcgc
ttccctgatgccaagccgcgctacgagggtgagtgggacttgctgcgacagagcatgatg
aggtttgggttaagaaacagccagtttatcgctctgatgcccactgtcacctcgtctcaa
gtgtcggaagtgagcgagggctttgcgcccctgtttacgaacatgtttagcaaggtcact
aaagaaggcgagctcttgcgccccaacatcctcctcttgagggaactgcgaaaaacattt
ggtggtaagcgtctattggacgtgttggacaaactggatagcacgcaatggtctgtagag
aaggcacttccatgcttggcacctaaccatcccttgcggaagttcaaaaccgcctttgac
tatgaccaaacgctgctcatcgacctctgtgcagaccgcgccccttatgtagatcacagc
caatctatgacgctgtatgtttcagagagcgcaaacgggacgctgcccgcctccaccctg
acacgccttctcatccacgcatataagcgaggcctgaaaacaggcatgtactactgcaag
gttcgcaaggcaaccaacagcggtgtcttcggtggcgacgaaaacctcgtctgcaccagc
tgcgtcctttag

DBGET integrated database retrieval system