KEGG   Viruses: 22277200
Entry
22277200          CDS       T40000                                 

Gene name
PI30_gp35
Definition
(RefSeq) Shigella phage POCJ13; Shiga toxin Stx1a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Diegovirus; Shigella virus POCJ13
Organism
vg  Viruses (Shigella virus POCJ13)
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-GeneID: 22277200
NCBI-ProteinID: YP_009100257
RS: NC_025434
UniProt: A0A088CBJ2
LinkDB
Position
NC_025434:21858..22127
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system