KEGG   Viruses: 24284827
Entry
24284827          CDS       T40000                                 

Gene name
AA805_gp22
Definition
(RefSeq) Papio ursinus cytomegalovirus; UL141
  KO
K21049  Cytomegalovirus protein UL141
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; NC_020231  Caviid herpesvirus 2 strain 21222
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: UL141 LapA_dom
Other DBs
NCBI-GeneID: 24284827
NCBI-ProteinID: YP_009137438
RS: NC_027016
UniProt: A0A0F7CSU8
LinkDB
Position
NC_027016:52357..53664
AA seq 435 aa
MRPVRFPRGSARNGTEDETAQLITERGRCSKRPAYVGLGRERTIQDRFPSVEFSVPRPMV
PRVAAMPVRRAVAALAVVLISSLAPGARSTDIDHLSWDQCYEDNSPAPLIMPLGSQITIP
CTFLPHSWPMVSIRARFCQSEYAGHELMVNVTNGTLVRDDLTGRLSNASWSFVDLGLAHY
IALTLNVTNNTTAMFDCVLRNASHGRIEKRFTVITFVETLQRPGEPDCQPKLGFNADGDK
IWTAGYNEWQRHTCGTFYGFDRVFYYLATTNRSNHKPPCPPSAPDRCWPVVQQYILDGDC
FRIQVPRRRKIHPHLFPDDGQEDDFIELPWVTLGLTVFLIGALCAALMLIIRMTCGKCYR
RYERFQKKKHGYRPVSGLFVRAAEYDELYCSVDDDDYDDECSKSYEALFECESPEPPYPD
DNDDPPLYSEIKRRL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgcgtcccgtgcggtttccgagagggtcggcgaggaacggaacggaggatgaaaccgcg
cagctgataacggagcggggccgctgttccaaacgccccgcgtacgttggattgggccgg
gaacggactattcaggacaggtttcccagcgtggagttctccgtaccacgaccgatggtg
ccacgggtcgcagccatgccggtgcggcgtgccgtagcggctctggccgtcgtcctgatc
agcagcctggccccgggagcgagatcgacggacatcgaccacctgtcatgggaccaatgc
tacgaggacaactccccggcgcccctcatcatgccgctgggatcgcagatcactattccc
tgcacctttctgcctcactcgtggcccatggtttccatccgcgcccgtttctgtcaatca
gagtatgcaggtcatgaactcatggtgaatgtgacaaacgggacgctggtgagagatgat
ctgaccggccgtctatcgaatgccagctggagctttgtggacctggggctcgctcattac
atcgccctgactctgaacgtgacgaataacaccactgccatgtttgactgcgtgttgcgc
aatgccagccacggacgcatcgagaaacggtttacggttatcacttttgtagagactttg
cagcggcccggggaacccgattgccagcccaagctggggttcaatgccgacggtgacaag
atctggaccgccgggtacaatgagtggcagcgccacacgtgcgggactttctacggcttt
gatcgagtgttctactacttggccactactaaccgctccaaccacaaaccgccttgccct
ccgagtgcacccgatcgctgctggcccgtcgtgcagcagtacatcttggacggggactgc
tttcgcatccaggttccccggcgccgcaagatacacccccatctgttccctgatgatgga
caggaggatgactttattgaactaccctgggtgacactggggctgactgtgtttctgatc
ggagccctgtgcgcggcactgatgttgatcatccgcatgacgtgcggaaagtgctaccgc
cgctacgagcgcttccaaaagaagaagcacggctaccgacccgtgtctggactgtttgtg
cgcgcggctgagtacgacgagctgtactgcagcgtggacgatgatgactacgacgacgag
tgcagcaagtcgtacgaggcgctgtttgagtgcgagtctcccgagccgccttaccccgac
gacaatgatgatccccctttgtacagtgaaataaagagacgcttgtaa

DBGET integrated database retrieval system