KEGG   Viruses: 24284831
Entry
24284831          CDS       T40000                                 

Gene name
AA805_gp26
Definition
(RefSeq) Papio ursinus cytomegalovirus; UL122
  KO
K22775  Cytomegalovirus viral transcription factor IE2
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; unclassified Simplexvirus
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: Herpes_IE2_3
Other DBs
NCBI-GeneID: 24284831
NCBI-ProteinID: YP_009137442
RS: NC_027016
UniProt: A0A0F7G9M5
LinkDB
Position
NC_027016:67882..69060
AA seq 392 aa
MLAASEIKTEPGEDCLQLKYKHKSSRKPTSPSGFIVISDSEDEEEHSVSQESSSQPGVKL
TMTTQTTGSLGQMSVESSSSSSSSDSECCDECGGGSSPSTLASPISPLPPTPPPPVVMPS
TSSGITTSAKKPKTPKTKTTKRMASLDCEKVRSAMREKAGIVFTTPTVETKRGRVKAGEV
SRMFRATSRSLEYKNLPFTLTNVHQVLSETVNICKSMQVNNRGIMLIYTRTHEVKEAVDQ
ARVRLGRICNLAISTPFLMEHTMPHVHSADATRKTAEACQQGIRSAWDIKTVHTNELCPR
SSDYRTVIVHAATPVDFLGAIQVLIPLNQQFPKQVAIRIFSAENTNSFMLPIYDNASKMY
AVGQFDEPKDEELENLSMAIEKAIEDMNQESQ
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgctggccgcttcggagatcaagacagagcccggtgaagattgcttgcaactcaagtac
aaacacaagtccagcagaaaaccaacctctccttctggctttattgtgatctcagacagt
gaagacgaggaggagcactcggtctctcaagaatcttcctcacaaccaggtgtcaagctc
acaatgaccacccagactactggatccttgggtcaaatgtctgtggagagttcctcttcc
tcctccagcagtgactccgagtgctgtgatgagtgtggaggggggtcttcacccagcaca
ctggcctctcccatctcccctcttcctcccacaccgcctcctcccgtggtgatgcccagc
acatcatctggcatcaccaccagtgccaagaagcccaagactcccaaaaccaagaccacc
aagagaatggcctccctggactgtgagaaggtgagaagtgccatgagggagaaagctgga
attgtcttcaccactcctacagtggagaccaagagaggcagggtgaaagccggtgaagtg
tctcgcatgttccgtgccaccagcaggtcactggagtacaaaaacctgcccttcaccctg
accaacgtgcaccaggtgctgtctgaaaccgtgaacatctgcaaaagcatgcaagtgaac
aacagaggtatcatgctgatctatacccgcacccatgaagtgaaagaggccgtggatcag
gccagagtgaggttgggaaggatctgtaacttagccatctccactcctttcctgatggaa
cacaccatgccccacgtgcacagtgctgatgccacccgcaagaccgccgaggcctgtcag
caaggaatcagatccgcatgggatataaagaccgtgcacaccaacgaactgtgcccccgc
tcatctgactaccgcacggtgattgtccatgcagccacccccgtggacttcctgggagcc
atacaagtgctgattcccctgaaccagcagttccccaaacaggtggccatccgcatcttc
tctgcagagaacaccaactccttcatgctccccatctatgataacgcctccaagatgtat
gcggtgggccagtttgatgaacccaaagacgaagaactggagaacctgagcatggccatc
gagaaagccatcgaggacatgaaccaggagtcccagtga

DBGET integrated database retrieval system