KEGG   Viruses: 24284866Help
Entry
24284866          CDS       T40000                                 

Gene name
AA805_gp61
Definition
(RefSeq) Papio ursinus cytomegalovirus; UL55
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; NC_020231  Caviid herpesvirus 2 strain 21222
Taxonomy
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 DUF4763 Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 24284866
NCBI-ProteinID: YP_009137477
RS: NC_027016
UniProt: A0A0F7G9P4
LinkDB All DBs
Position
NC_027016:145848..148478
AA seq 876 aa AA seqDB search
MNKNWSRLLYVSLWAACVVSVSSGTNTSNASVATSTHAASSNSASQLSSTTPKPTINTTT
GALIENTTLRTHEVIKANISKFPYRVCSIAKGTDFLRFEQNIQCESFKPTKDDFDEGIMV
VYKRDIRAHTFKVNVYQKVLTQRQSYSYIYMNYMLGQTVERLPIPMWEVHYVNRINRCYN
SVKRHIAGQWYEVYHKDSYVNETMLLLEDYSNTHSSRFVTVKELWHKPGSTWLYTTSSNV
NCMVTVTTARSKYPYDYFVTSSGEVVDISPFYNGSNGKHFGENRDKFHIMKNYSMVQYYG
RENVPLVAHDLVAFFERADSMMSWDVLDEGNSTCQFTFWEKSERTIRSEADDTYHFTSNS
MTATFLTKKDPVNDSDSALDCIKQQAENKIEEIFNATYNSTYVKAGNVTIYETTGGLIVF
WLPVKEKSIWDMKKLADGYANMTNASTSSRTKRSTSDSTLLNNTEVIHNIVYAQLQFTYD
TLRNYINRALRQIAEAWCKDQRRTLEVLKELSKINPTAMLSAIYDKPVAARYAGDVISLA
KCVEVNQTTVQVLRDMHVKDDRELCYSRPVVLYRFYNSSHVQYGQLGENNEILLGRHRTE
ACEIPSVKIFIAGNTSYEYVNYLFKREVSLGSIPVVETMISLDIDPLENTDFKALELYSE
DELRASNVFNLEEIMQEFNAYKQRVVHVEGKVFDTVPTYLRGLDDLMSGLGVAGKALGVA
IGAVGGAVASFVEGIVGFIKNPFGSLTVILFLLAVLGVIYLIYMRQKRVYQQPIQQLFPY
IAPPPAPAKETPPPPSYEESVYASIKEKSSSSVKEFSSEEAFQMLLALHKLDAEKRQKLK
EESEQAASQSGKVGLLDRVRNRRRGYKPVEENEYEV
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaactggtcccggcttctctatgttagcctgtgggcggcttgcgtggtaagt
gtttcttctggtacgaatacgtccaatgcgtctgtggctacatcaactcacgcggcgtct
tcgaactctgcttcacagttatcgtcgactacaccaaagcctaccatcaacacgactact
ggagctctcatagaaaacacaactctgagaacgcatgaagtcatcaaggccaatatatcc
aaattcccatatcgtgtttgttcaatagctaaaggaacggactttcttcgattcgaacaa
aacatccagtgtgaatcattcaagcctaccaaagacgatttcgatgagggcatcatggtg
gtctacaagcgcgacatccgtgcccacacgttcaaagtgaatgtgtatcagaaggttttg
acgcaacgtcagagttactcgtacatttatatgaattatatgctgggacagactgtggag
cgtctgcctattccaatgtgggaagtgcattatgtgaacagaattaacaggtgttacaac
tctgtgaagagacatatagcaggccaatggtacgaagtgtaccataaagacagttatgta
aatgaaactatgcttctgctggaagattactccaatacgcacagttcgcgctttgtaacc
gtgaaagaactttggcataaacctggtagcacgtggctgtatacaacaagttctaatgtg
aactgcatggtgactgtaacgaccgccagatcaaaatatccatatgattattttgtaacg
tcgtctggtgaagtggtggacatttctcctttttacaatggaagcaatggaaaacatttt
ggtgaaaacagggataaattccatattatgaagaactattccatggtgcaatattacgga
agggagaatgttccactggttgcccacgatttggtggctttctttgaaagagctgactct
atgatgtcttgggatgttttggatgaaggtaacagtacatgtcaattcactttctgggaa
aagtcggaacgcaccattcgctctgaagctgatgatacttaccatttcacttctaacagc
atgacggcaacttttttaacaaagaaggatcccgtaaatgattcagattctgctttggat
tgcattaaacaacaggctgaaaataaaattgaggaaatttttaacgctacatataattct
acatatgtaaaagcaggcaatgtaactatctatgaaacaactggtggattgattgtattt
tggctaccagtaaaagaaaaatcaatttgggacatgaaaaaacttgccgatggatacgca
aacatgacaaacgctagtacatcctcacgtactaagcgatctacaagtgacagtacatta
ttgaacaatactgaagtaatacacaacattgtgtatgcgcaattgcagttcacttatgat
accttgagaaattacattaaccgcgctctgagacaaattgctgaagcctggtgtaaagat
caaagaagaacacttgaagtccttaaggaactgagcaaaatcaatcctactgctatgttg
tctgccatctatgataaaccagttgctgctcgatatgctggagacgttataagcttagct
aagtgtgttgaagttaaccaaactacagttcaagtgctccgtgacatgcatgtaaaggat
gaccgtgaactttgttattctcggcctgtggtgttgtacagattttacaacagttcgcat
gttcagtatggccagctgggagagaacaacgaaattttgttgggacgtcatcgtactgaa
gcatgcgaaattcccagcgtgaaaatttttattgctggcaacacttcgtacgaatatgtg
aattatctgtttaagagagaagtttccttgggtagtattccagtggtggaaaccatgatt
tccctggatattgatcccttggaaaacacagactttaaagctttggaactgtactccgag
gatgaactgcgtgccagcaacgttttcaatctggaggagattatgcaagagttcaacgct
tacaagcaacgggtcgttcacgtggaaggaaaggtgttcgacaccgttcctacatatctc
aggggcctggacgacttgatgagcggtcttggtgtagcgggcaaagctttgggtgtggcc
atcggagccgttggcggtgccgtggcttcctttgtggagggcatcgttggtttcatcaaa
aacccgtttggttctctgactgtcatactctttctgcttgctgtattgggtgttatttat
ttgatttacatgcggcaaaaacgcgtgtaccagcagcctatccagcagcttttcccgtat
atcgctccaccgcctgcgcctgctaaagagaccccgcctccaccttcgtacgaggaaagc
gtgtatgccagcataaaagagaaatcgtcctcttcggttaaggaattcagttcggaggag
gcttttcagatgctgctggctctgcataaactggacgcagaaaaacgtcaaaagctaaag
gaggaatcagaacaggctgcctcgcagagcggcaaggttggccttctcgatcgcgttcgc
aaccgccgtcgaggctacaaaccggtggaggagaacgagtacgaggtgtga

DBGET integrated database retrieval system