KEGG   Viruses: 24284879
Entry
24284879          CDS       T40000                                 

Gene name
AA805_gp74
Definition
(RefSeq) Papio ursinus cytomegalovirus; UL38
  KO
K22776  Cytomegalovirus apoptosis inhibitor UL38
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; NC_020231  Caviid herpesvirus 2 strain 21222
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 24284879
NCBI-ProteinID: YP_009137490
RS: NC_027016
UniProt: A0A0F7G9Q4
LinkDB
Position
NC_027016:174634..175509
AA seq 291 aa
MAACLEYEQERERQQAQLNIGYLVQASIMGPTALRAQVKKLMARETRIRHEFGVTVCVCD
CTYPFLCITVSKIACLERNCPPLQHGLTMFGVIEAWEEAAPRPSRQVVLFMSDNYDIFAY
DAGILFYMAPTMSDFWTAPIVFEYWNGIFPVEIRHRVRQYARTIDDLIVIFHQVYHQRDV
LEARRLKNHNSPRTFARFLCGYVRALLDAERRVREGKIPVPFVDRDSLMLNVIAPPTPKQ
DSPEPGNTPGKKALTRQCSLPTSNPKKRAEADPDSSDEEIIDLTMEGVDAL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggctgcatgtctagaatatgagcaggagcgggagaggcagcaggcacagctgaacata
ggatatctcgttcaggcttccatcatgggtcccacggcgcttagggctcaagtcaagaag
ctgatggcgcgcgagacacgcatccgacacgagttcggtgttaccgtctgtgtttgcgat
tgcacctatccgtttctgtgcatcaccgtgtccaaaatcgcgtgcctggagcgcaactgc
ccgcctctgcagcacgggctgactatgtttggggtgattgaagcttgggaggaggctgcc
cctaggccttccagacaggtggtgctgttcatgagtgacaattatgatatattcgcttat
gatgccggcatcctgttttacatggcacccaccatgtcggacttttggactgcgcccatc
gtctttgagtattggaacgggatttttcccgtggagatcaggcaccgggttcggcagtac
gccaggaccatagacgacctgattgtcatttttcaccaggtgtaccatcagcgggacgtc
ttggaggctcgtcgtttgaaaaaccacaacagtcctcggaccttcgccagattcctctgc
ggttatgtgcgcgccctcttggatgccgagagacgtgtccgagagggaaagataccggtg
ccgtttgtagatcgggacagcctgatgctcaacgtgatagctcctccgacccctaaacag
gattcgccagaacctggcaacacgccaggaaagaaagcactgactcgccagtgttcgctc
cctacttccaatcctaagaaaagggctgaagccgatcccgatagtagcgacgaagagatt
atcgatttaacgatggaaggcgtagatgccttgtaa

DBGET integrated database retrieval system