KEGG   Viruses: 25026421Help
Entry
25026421          CDS       T40000                                 

Gene name
UL55, CeHV-5_gp067
Definition
(RefSeq) Cercopithecine betaherpesvirus 5; envelope glycoprotein B
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
TAX:50292
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Taxonomy
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 DUF4763
Motif
Other DBs
NCBI-GeneID: 25026421
NCBI-ProteinID: YP_004936031
RS: NC_012783
UniProt: G8XTC7
LinkDB All DBs
Position
NC_012783:complement(76887..79520)
AA seq 877 aa AA seqDB search
MSRTLFLLLSVSLWAVCMVSVTSSSNGTSSSTSSVASSTNVSSGFSQSASTTSSPVNMTT
GPLIANTSVRTHEVIKADVAKFPYRVCSMAQGTDLLRFEQNIECESFKPTKEDFDEGIMV
VYKRNIKPYTFKVTVYQKVLTQRQSYSYIYVNYMLGQTVEHLPVPLWEVHYINRLNRCYN
SVKRTMSGKVYDTYHKDSFVNETMLLLEDYSNTHTSRFVTVKELWHKAGSTWLYTTSSNV
NCMVTVTTARSKYPYDFFVTSGGEWVDISPFYNGSNHKHFGENQDKFHIYKNYSMVEYYG
RENVPEKTHRLMAFFQRADSLMSWDIEDQNNSTCQFTFWEQSERTIRSEAEDTYHFTSGS
MTATFLSKKTPVNDSDPALECIKDEAERKLQEIFNTTYNSTYVQSGNVTVYETTGGLVVF
WLPVQERAIWEMKQLADGYTNLTNATSSRQKRSVENASELLNSDVLHTVVYAQLQFTYDT
LRNYINRALRQIAEAWCKDQKRTQEVLKELSKINPTAMLSAIYDKPVAARYAGDVISLAK
CVEVNQTTVQVMCDMHIKDKEKENLCYSRPVVLFRFYNSSHVHYGQLGEHNEILLGRHRT
EVCETPSMKIFIAGNTSYEYVDYVYKREIPLDTIPIINTMISLDIDPLENTDFKALELYS
EEELRASNVFNLEEIMQEFNNYKQRVVHMEGKVFNDVPTYLKGLDDLMSGLGSAGKALGV
AIGAVGGAVASIVDGIVGFIKNPFGSLTMILFLLAVLGVIYLIYTRQQHMYQSPVQHLFP
YIPPAAAPVKETPPPPSYEESVYSSIKEKPSASSTKFSVEDAYEMLLALQRLDEEKRGKD
KDSRRTVSLEGGQHVGLLDRIRNRRRGYTQVENEYEV
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaccttgttcctgcttctctctgttagcctgtgggcggtttgcatggtaagt
gttacgtcttccagtaatggtacgagttcgtctacctcgtctgtggcttcgtcaactaat
gtttcctcgggcttttcacagtccgcgtctacgacaagttctccggtgaacatgactact
ggtcctctaattgcaaataccagtgtaaggacacatgaagttatcaaggctgacgttgca
aagtttccatatcgcgtatgctcaatggctcaggggacggatcttcttcggtttgaacag
aacattgaatgtgaatcattcaagcccacaaaagaagatttcgatgagggtattatggtg
gtgtacaaacggaacatcaagccgtataccttcaaagtgactgtgtatcagaaggtttta
acgcagcgtcaaagttattcttatatttatgttaattacatgttaggacaaactgtggag
catttgcctgttccactgtgggaagtgcattacattaacaggttaaacagatgttacaac
tccgtgaagagaacaatgtcaggaaaagtctatgatacctatcataaagacagctttgta
aatgaaactatgctcttgctggaagactactctaacacgcacacttcgcgcttcgtaacc
gtgaaagaactttggcacaaggccggtagcacgtggttgtatacaacaagctctaatgta
aactgcatggtgaccgtgacgactgcgcgatcaaaatacccatatgatttttttgtgact
tctggcggcgaatgggtagacatctctcctttttacaacggcagcaatcacaaacatttt
ggtgaaaaccaagataagtttcatatttacaaaaattattccatggtggaatactatgga
cgagaaaatgttccagaaaaaactcatcgtttaatggctttttttcaaagagcagattcg
ctaatgtcttgggatattgaggatcagaacaacagtacctgtcaattcactttttgggaa
caatcagaacgcactattcgttcggaagctgaggatacatatcattttacatctggtagt
atgactgccacattcttgtctaaaaagactccggttaatgattctgatccagctttggaa
tgcataaaggatgaggctgaaagaaagctgcaagaaattttcaacacaacatataattca
acttacgtgcagtctggaaatgttacagtgtatgaaacaactggcggcttggtcgtgttt
tggttgcctgtacaggaacgagctatctgggaaatgaaacaattggccgatggatataca
aatctaactaatgcaacatcgtcgcgtcagaagcgatctgttgagaatgccagcgaactc
ttgaacagtgatgtccttcataccgttgtgtacgcgcagctgcaatttacttatgataca
ttaagaaattacattaaccgtgctctgagacagattgctgaagcctggtgtaaagatcaa
aagcgaacgcaagaggttctgaaggaattaagtaaaattaaccctactgccatgttgtct
gcaatttatgacaagccagttgcagctcggtatgctggagatgttattagcctggctaaa
tgtgtagaggtaaatcaaactactgttcaagtgatgtgtgacatgcatataaaggataaa
gaaaaagaaaatctctgctactccaggccggtggtactgtttaggttttacaacagttca
catgttcattacggacagctcggagaacataatgaaattttgttggggcgtcatcgtacc
gaagtatgtgagactcccagcatgaagatttttattgctggcaacacctcgtacgagtat
gtggactatgtgtacaaaagagaaattccgttggacaccattcctatcataaataccatg
atttctttggatattgatccattggaaaacacggactttaaagccctggaattgtattct
gaagaggaattgcgagcaagcaacgttttcaatctggaagaaatcatgcaggagtttaac
aattacaagcagagggttgttcacatggaaggaaaggtgtttaatgatgtgccaacgtat
ctgaaaggcttggacgatctaatgagcggcctcggttcagcgggaaaagcgttgggcgtg
gccattggagctgttggcggcgccgtggcttccatcgtggacggcatcgttggttttatc
aaaaatccatttggttctctcaccatgatactcttcctgctggcggtgttgggcgttatt
tacttgatttacacgcggcaacaacacatgtaccagagccccgtgcaacatctgttcccg
tacatccctccagcggccgcgcctgtaaaagaaactccgcctccgccttcgtatgaagaa
agcgtctattccagcataaaagagaaaccatctgcttcatctacaaaattcagtgtggag
gacgcctatgagatgctgttggctttgcagaggctagatgaagaaaaacgcggaaaggat
aaggactctcggcgcactgtgtctctggaaggtgggcagcacgttgggcttctagatcgt
attcgcaaccgccgccggggctacacacaggtggaaaacgagtacgaggtgtga

DBGET integrated database retrieval system