KEGG   Viruses: 25026451
Entry
25026451          CDS       T40000                                 

Gene name
UL33, CeHV-5_gp045
Definition
(RefSeq) Cercopithecine betaherpesvirus 5; envelope glycoprotein UL33
  KO
K22782  Cytomegalovirus G-protein coupled receptor UL33
Taxonomy
TAX:50292
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv DUF1345 DUF2207
Other DBs
NCBI-GeneID: 25026451
NCBI-ProteinID: YP_004936009
RS: NC_012783
UniProt: G8XTA5
LinkDB
Position
NC_012783:join(43002..43028,43105..44274)
AA seq 398 aa
METILHNQTVRNDSILHINNTCVVTDSLRAAKTGEALINTALALFGTPLNAIVLITQLLA
NRVQGYSTPIIYMTNLYSANFITLLVLPFIVLSNQHLLPANAGLCKFLSLLYYSSCSVGF
ATVALIAADRYRVIHRRTQARQSYRNTYLIVLLTWAIGLICATPGGVYTTIVAHADGQND
IEHNTCIMHFIYEEMYVLMFWKILIVLAWGVVPVIMMVWFYAFFYSTVQRTAQKQQRTLQ
FVKVLLLSFIIIQTPYVSIMIFNAYATVGWSLECNDLTKRRVISTFSRIVPNLHCVVNPI
LYALLGNDFTTKVRQCFRGELMSRRSFLRSRQQAQNSDEPQTAVTHTTAAAALTETPKCK
PNVKRGMSFGARPSPEVAAAKKAKTKRLSQSYNNLRMP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggaaaccatccttcataatcagacggtacgaaatgacagtattttgcacatcaacaac
acctgtgtggtgactgactcgctccgcgctgccaagactggcgaagccctcatcaacacc
gcgctagctttattcggtacccccctcaacgccatcgttctcatcacccagttactggcc
aaccgcgttcaaggttactctaccccgattatctatatgaccaatctgtactcggcaaat
tttatcaccttactcgttcttccttttattgttctgagcaaccagcaccttcttccggcc
aacgcggggctatgcaaatttctctctctcctgtattactcaagctgcagcgtaggcttt
gccacggtggcactaatagcagcagacagataccgggttattcaccgtagaacccaagcg
cgccagtcataccgcaacacctacctcatagtacttttgacatgggcaattggtttaatt
tgcgccaccccaggaggagtttacacaaccattgtggctcatgcagatggtcaaaacgac
attgaacataacacttgcatcatgcactttatctacgaagagatgtacgtgcttatgttc
tggaaaattctaattgtgttagcttggggcgtggtgccagttattatgatggtttggttc
tacgcgttcttctatagcaccgttcaaagaacggctcagaagcagcagcgcacgttacaa
tttgttaaagtactgcttctgtcattcattatcatccaaaccccatatgtgtcaatcatg
atcttcaacgcttacgctaccgttggctggtcactagaatgtaatgacttaactaaacga
agagtcatcagtaccttttcccgcatcgtccccaacctccactgcgtggtcaaccccatt
ctttatgctctcctgggaaatgactttaccaccaaagtgcgccaatgcttccggggagaa
cttatgagccgccgaagctttctcagatctcggcaacaagcccagaactcagacgagcct
cagacggcagtgactcacaccacagccgctgccgccctcacggaaactcccaaatgcaaa
ccaaatgtgaagcgcggcatgtccttcggcgccaggccctcccctgaagtcgcagcggcc
aaaaaagccaagacaaagcgcctttcacagtcttacaataatttacgtatgccgtaa

DBGET integrated database retrieval system