KEGG   Viruses: 25026454
Entry
25026454          CDS       T40000                                 

Gene name
UL36, CeHV-5_gp048
Definition
(RefSeq) Cercopithecine betaherpesvirus 5; tegument protein vICA
  KO
K22788  Cytomegalovirus viral inhibitor of caspase-8-induced apoptosis
Taxonomy
TAX:50292
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 25026454
NCBI-ProteinID: YP_004936012
RS: NC_012783
UniProt: G8XTA8
LinkDB
Position
NC_012783:complement(join(47340..48544,48622..48847))
AA seq 476 aa
MSYRLVSGMDDLRDTLMAYGCIALHAATPASLFDFLDRESGTRLHVAWPEGAMIQLRPRT
LLGHFSPKYYDVCLQGKYVCCEEAMEPFGVVELTKIGSYQLIMMIGRSGAVYCYEEMEKC
VSCLAPDMKAFMKLGLRHCEYLHKEETYQCPLITYDDEIIKRLLKFDWEEDQLSGILNKD
NHTIYKINDPTGEQVDTHFALWSSDSNIIKFKDTCFSVMRPEGFRSFEIMVRCVPRLVCM
NQLLGALGCILESGEFLVRLYVLADKFGVIYGFDPFINGIYRLADTFRMFTCVMGQKGHQ
NHRYDRKRAGTVRLEKIPYCLHGREPVDPMNMFNDDDDDESEQAPKTTAEVVERIHASIR
GHLQFCVTSVMLDSPASGRLWPQELEALSDSLILQSLPYDADEVRCKLLGGIADMRAFEM
SFVGTAEDDDSDREETVRGYLFDESVCERCVANRRLRLFRAGRGSQRGNRSRVSYV
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgagttatcgcttggtgagcggcatggatgaccttcgggatactttgatggcttacggc
tgcattgctttgcacgctgcaactcctgccagtttgtttgactttttggacagagagtct
gggacccgattgcacgtcgcttggcctgaaggtgctatgatccagcttcgccctcgtact
ctattgggtcatttcagtcccaaatattatgatgtgtgccttcaaggaaagtacgtgtgc
tgcgaggaagccatggaaccctttggagtggtggaacttacaaaaattgggtcctaccaa
ctcatcatgatgatcggtcgcagcggtgccgtgtattgctacgaggaaatggaaaaatgt
gtttcttgcttggcacccgatatgaaggcctttatgaaacttgggttgcgtcattgcgaa
tatcttcataaagaggagacctatcagtgtccattgattacatatgatgatgagatcatc
aaacggttgttaaaatttgactgggaggaagatcagttgagtggaatactgaacaaagat
aatcataccatttataaaattaatgaccctactggtgagcaggtagacacccactttgct
ctttggagcagtgatagcaatattatcaagttcaaggacacctgtttcagcgtcatgcga
cctgaaggctttagaagttttgaaatcatggtacgatgtgttccccgtttggtatgcatg
aatcagttgctcggggcgcttggctgcatcttagagtcaggagaatttttggtgagactc
tacgtgttggcagacaaatttggcgtgatctacggctttgacccgtttattaatggcatt
taccgtctggccgataccttccgtatgtttacatgtgtcatgggccagaaaggtcatcag
aaccatcggtacgatcgcaaacgtgcaggcaccgtcagactggaaaaaattccgtattgt
ctgcacggtagggaacccgtggatcctatgaacatgttcaatgatgacgatgatgatgaa
tcagaacaagcaccaaagaccacggccgaagtggtggaacgaattcatgctagtattagg
ggccacctgcaattttgcgttaccagcgtgatgctagacagtcctgccagcggcagactg
tggccccaggaactggaagccctctccgattcgctgatcctgcaatcgctgccctatgac
gcggatgaagtgaggtgcaagcttctcggtggcattgccgacatgagagcttttgaaatg
tcctttgtcggaaccgctgaggatgacgattccgatcgcgaggagacggttcgaggctac
ctctttgatgaaagtgtgtgtgaacgctgtgtggcgaaccggcgtctccggctgttccgc
gccggccgcggttctcagcgcggtaaccgcagtcgggtctcttatgtgtga

DBGET integrated database retrieval system