KEGG   Viruses: 25026457
Entry
25026457          CDS       T40000                                 

Gene name
UL38, CeHV-5_gp050
Definition
(RefSeq) Cercopithecine betaherpesvirus 5; protein UL38
  KO
K22776  Cytomegalovirus apoptosis inhibitor UL38
Taxonomy
TAX:50292
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 25026457
NCBI-ProteinID: YP_004936014
RS: NC_012783
UniProt: G8XTU4
LinkDB
Position
NC_012783:complement(50112..50993)
AA seq 293 aa
MAAAAALEEYHQEREMQQAQMDIGLLVQASILGPTSLRARVKQLMGRDTRIRHEFGVTVC
ICDCTYQFLCITPSKISWLERNCPPLQHSLTMFGVIEAWEEAAPRPSRQVVLFMSSNYDI
FAYDAGILFYLAPTMSDFWTAPVVFEYWNGIFPLEIRHRVRQYAKTIDDLTVIFHQVYHQ
RDVLEARRIKNSTTPRTFARFLCGYVRALLDAERRVREGKIPVPFVDRDSLLANVIPVAP
TPNPETEGRPEKKALTRQCSLPTPHPKKLGVQPDSDSDSDTIIDLTMEGAASL
NT seq 882 nt   +upstreamnt  +downstreamnt
atggctgcggctgctgctttagaagagtaccatcaggagcgagagatgcaacaagctcag
atggatatagggctccttgttcaagcttctattttggggcccacgagcctcagagctcgg
gttaagcagctcatggggcgagatacgcgcatcagacacgagtttggtgtcactgtctgt
atctgtgattgcacttaccagtttctgtgcatcaccccgtccaagatctcttggctggaa
cgcaactgcccgcctctgcagcactcgctaactatgtttggagttattgaggcttgggaa
gaggccgctcccagaccttctaggcaggtggtgctgtttatgagtagcaactatgatatc
ttcgcttacgatgccggtattctgttctatctggcacccaccatgtctgacttttggacc
gcgcctgttgtatttgagtattggaacgggatatttcctctggagatcaggcatcgggtt
cgtcagtacgctaagacgatcgatgacctgactgtcatctttcaccaggtctatcatcag
cgagacgtattagaagctcgccgcatcaaaaacagcaccacacctcggacctttgccagg
ttcctatgcggctacgtcagagctctactagacgcggagagacgcgttcgcgagggaaaa
atcccagtaccctttgtggatcgcgatagcctgttggccaacgttattcccgttgcccct
acgcccaatccggaaactgaaggaagaccggagaagaaagcactgacacgacagtgttcg
ctccctacccctcaccctaagaagctcggagtccagcctgattccgatagcgacagcgat
acgattatcgatttaactatggaaggcgcggcatctctgtag

DBGET integrated database retrieval system