KEGG   Viruses: 25026486
Entry
25026486          CDS       T40000                                 

Gene name
UL82, CeHV-5_gp084
Definition
(RefSeq) Cercopithecine betaherpesvirus 5; tegument protein pp71
  KO
K22779  Cytomegalovirus tegument protein pp71
Taxonomy
TAX:50292
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 25026486
NCBI-ProteinID: YP_004936048
RS: NC_012783
UniProt: G8XTE4
LinkDB
Position
NC_012783:complement(106803..108440)
AA seq 545 aa
MDRPPEEEEEPRPSTSRAAAPAATFDRLTCHVLRMITTQSTTMETNAVKVIDWHANIQVA
NPAVICTFQEVKSPRDPLQLTDLNLKGRCSSTLRDSLRTDVCNFSDTRLRSGSNTMSVLV
FALPLVRVPVTGIHLFRGRAQSENRPPRANARVTIRRAQYMWTVKVNLTGINWSRRRDSH
TEGGQFFTSDFTFATDLMPLTVVDAMDQLACSDADTYIQKAETVGEQNLIRVYIIHLSGH
PPAELFLQMSVYSHRAEVICRHNPAPFFERHAENGFLVRNPHTVNIPAHHTHVAHFNNAI
ETQGTCHLLFFPIDIPGLSIEAGPLTSRMKITLKIQNLTQTAITVNYMQMLGFIHFFPRG
SLATMPNRTQTPRCSQTRLRAGLFPRDVIMRGVISQFVEQNSSSSEEEEEDEPVPLTPPI
LTEAIFAPFQSENDSTSDEDEEEPTTSARLRAEARARREAGQPPVPERPPPTVQLLSLPC
WNMYIHTDLLLPITARIEDTAVKATSYLRSELEGDICTAADLQSTFQELMAPLPARRSPT
ARPRI
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggatcgccctcccgaggaggaagaagagcccaggccatctacctctcgggccgccgca
ccggccgccaccttcgaccgcctcacctgccatgtgttgagaatgataactactcagagc
accaccatggagacaaacgccgtgaaagtcatagactggcacgccaacatacaggtagcg
aatccagccgtcatctgtaccttccaagaggtaaaatcacctcgcgacccgctgcaactc
acggaccttaacctcaaaggacgatgcagctccacactcagagactcgctacgaacagat
gtgtgcaatttttccgacacacgccttcggagcggtagcaacaccatgtccgtgctggtt
ttcgcgctacccttggtacgagtgcccgtcactggaatccacctgtttcgcgggagagca
cagagcgaaaaccgcccgccaagggccaacgccagagttaccatccgccgggcccaatac
atgtggaccgttaaggtcaacttaactggcatcaactggagccgccgaagagattcgcac
accgaaggcggtcagttcttcaccagcgactttacgtttgccaccgacttgatgcccttg
acggtagtcgacgctatggatcagctggcctgttcggacgccgacacctacatccagaaa
gcagaaaccgtgggagaacaaaacctcataagagtttacatcatacacctatctggacac
ccgccagcagaactgtttttgcaaatgtccgtctactcccaccgggccgaagtgatatgc
cgccacaatccggcaccgttcttcgagagacacgctgaaaacggcttcctcgtgagaaac
ccgcacaccgtcaacattcccgcgcaccatacgcacgtggcacacttcaacaacgcaatc
gaaactcagggcacttgtcatctcctgttcttccccatagacataccaggactcagcatc
gaagcgggtcctttgaccagccgcatgaagatcaccctgaaaatacaaaacttaactcaa
acagccatcactgtcaattacatgcagatgcttggattcattcatttctttccccggggc
agtctcgccaccatgccgaacagaacgcaaactccgagatgctctcaaacccgcctgcgc
gccggcctgtttcctagagatgttatcatgcgcggcgtcatctcacagtttgtcgaacaa
aactcatcctccagcgaagaggaggaagaagacgaaccagtcccactgactccgccgatc
cttaccgaagccatctttgctcccttccagagtgaaaacgattctacctcagacgaagat
gaggaggaacccaccacaagcgcccgactcagggcagaagctagagccaggcgagaagcc
ggccaacctcccgtcccagaacgtcctccccccacagttcagctgctcagcctgccatgt
tggaacatgtatatacacacagatctccttttacccattaccgccagaatagaggacaca
gcggtcaaagcaacgtcttatctcagatccgaactggaaggagacatctgcaccgccgct
gacctccaatctacctttcaggaacttatggcacccctccctgcccgccgctcgcccacc
gcgagacctcgaatctag

DBGET integrated database retrieval system