KEGG   Viruses: 25026487
Entry
25026487          CDS       T40000                                 

Gene name
UL83B, CeHV-5_gp086
Definition
(RefSeq) Cercopithecine betaherpesvirus 5; protein UL83B
  KO
K21045  Cytomegalovirus tegument protein UL83
Taxonomy
TAX:50292
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 25026487
NCBI-ProteinID: YP_004936050
RS: NC_012783
UniProt: G8XTE6
LinkDB
Position
NC_012783:complement(110344..111915)
AA seq 523 aa
MATSSPERHDDEFITVISGTVIKAIFSESPKLIPTNTTGILKSGIKVKVNQPSAVFVTQC
TQESQPCKRYDIDLQVKHTTFEVRDIDNVAVDVYNPTDQGILTSAGPLSFYIYAIPLDIV
AIPQLFLHPGENRKHRIPVADTVVQEVEGGWHTRLTVSRLVWSRNQSRYRPNSMFHTTSF
IFNAQNMPLDVTNTADELVCSLPDTHVTNVQKISKREVKVYMECTREDPPENKAFVHLSW
KNGRSDVVMSRNPKPFLTPHDRNGFIISCPQNLHLKPGKTSHLMFDIHYESTKYVAIICP
KAIPGVSISCNPLLPTQTLFLEVRATQDSIHLDKWETLGWLYFIKRNLLLTKGPTGVEHF
NFIDQYRLMAKLEYENIYSEQADEDCSDSSCSDSDMECSYATMKRPPPPPSRSGRQSSTK
GKRFPKTERDDDHSDDENQDNMTLCWPNWQCAIKVKNLTPIVVSADSDNVPADQFFWGQK
DFFRIFYATESEWQPCPTQRRRRHTRSEPGSAPYTASVKKHRS
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggcaacatcaagccccgaacgtcatgatgacgaattcataaccgtcatatcgggaacc
gtcatcaaagccatctttagcgagagtccaaaattaataccgacaaacacaaccggcatt
ctgaaatcgggcattaaagtcaaagtcaatcagccatcagcagtctttgtcactcagtgt
actcaggaatcgcagccatgcaaacgctacgacatcgaccttcaggtcaaacatacaaca
ttcgaggttcgagacatcgacaacgtggccgtagacgtgtacaaccccaccgaccaaggc
attctgacctcagcaggcccgttgtcgttctacatctacgccatcccgcttgacattgtc
gcgattccacagttatttcttcatccgggtgaaaatcgcaaacatcgcattcccgtagcc
gacacggtagtgcaggaggtagaaggcggatggcacacccgactcaccgtgtcccgtttg
gtttggtcacgaaatcagagccgctatagacccaattccatgtttcacaccacgtcattt
atttttaatgcgcaaaacatgccactggatgtcaccaacacggccgacgaacttgtgtgt
tccctacccgacactcacgttacaaacgtccaaaagatcagcaaacgcgaggtgaaagtt
tacatggaatgcacccgagaagaccctccggaaaacaaagcttttgtccatctgtcgtgg
aagaatggccgcagtgacgttgtcatgagccggaatccaaagccgttcttgacgccgcat
gacagaaacggtttcatcatctcatgccctcagaaccttcacctgaaaccgggcaaaacc
tcacacctcatgttcgatatacactacgaatccaccaaatacgtcgctatcatctgcccc
aaggccattcccggagtcagcatctcgtgcaacccgctcctgcctacacagacgctcttt
ttggaagttagagctacacaggacagcattcaccttgacaaatgggaaacactgggatgg
ctgtatttcatcaagcgcaatctgctcctcactaaaggccccacgggcgtcgagcatttc
aactttatcgaccagtaccggctcatggctaagctagaatacgaaaacatctacagcgaa
caggccgacgaagactgtagcgactcatcgtgctcggactccgacatggaatgctcctat
gctacaatgaaacgaccaccaccgccgccatcgaggagcggcagacagtcgtctacgaaa
ggtaaacgattccccaaaacagaacgtgacgacgaccattccgacgacgaaaatcaagac
aacatgacgctatgctggcccaactggcaatgtgcgatcaaggtgaaaaatctcaccccg
atcgtcgtcagtgccgattccgataatgtccccgcagaccaattcttctggggacaaaaa
gatttcttccgaatcttctacgctacggaaagcgaatggcaaccgtgtccaacgcagaga
cgccggcgccacacgcgttccgaaccgggttcggcaccatacaccgcgtccgttaaaaaa
caccgtagctaa

DBGET integrated database retrieval system