KEGG   Viruses: 25026518
Entry
25026518          CDS       T40000                                 

Gene name
UL122, CeHV-5_gp116
Definition
(RefSeq) Cercopithecine betaherpesvirus 5; regulatory protein IE2
  KO
K22775  Cytomegalovirus viral transcription factor IE2
Taxonomy
TAX:50292
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: Herpes_IE2_3 Herpes_IE1 ANAPC1
Other DBs
NCBI-GeneID: 25026518
NCBI-ProteinID: YP_004936080
RS: NC_012783
UniProt: G8XTH6
LinkDB
Position
NC_012783:complement(join(155637..157060,158813..159006,159126..159247))
AA seq 579 aa
MDPRQTKRKADDQPPQHTEGDPGEGTSAGPEPGPSPPKMPRHEDHGTERAVQYLEKLLAE
ETRGILSLGDPLFGYADVPGDEPFKTLEEIINEEPDDPLGKVQTIGGASESDILAQAVNQ
AGIDHSSAGTTITTPSIFTTTTAPSTPQGVVTQPESQPMPPPVCNPETLFIPRKKSRKTD
CPTKIIIKPPVPPTSTMIPASQIKKEPEEFFKLQYKDQDIQPTSGCIVISDSEEEEDTQT
LIPTASSSSENQGVQLTMTTPGSGSVGKMSVESSSSSSSESECCEECGLSSPSTLASPVS
PIPPPPPAPVMPSTSGAKPKGPKTKTTRRITSLDCERVRSAMKEKGGVTFTNHKVETKRG
RVKQDDVSRMFRLTNRSLEYKNLPFQLTNVHQILSEAVAVCKTMQVSNRGIMLIYTRTHE
VKEAVDAARIRLGGICNLAISTPFLMEHTMPHVHNSEVTRKTAEACQQGLRAVWDLKTVQ
PHNLCPRSSDYRTMIINAATPVDFLAAIQVLIPLAQQFPKQVAIRIFSAENTSSFMLPIY
ENASRMYAVGQFEEPKDEELENLSMAIEEAIRDMQEDSQ
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggaccccagacagaccaagagaaaggctgatgaccagcctccacaacacactgaggga
gaccctggtgagggaacctctgctggacctgaacctggaccatctccacccaagatgccc
agacatgaggatcatgggactgagagagctgtgcagtaccttgagaagctgttagcagaa
gagacaagaggtatcctgagcctgggagaccccctgtttggctatgcagatgtgcctggg
gatgagccctttaagacccttgaggagatcattaatgaagaaccagatgatcccttagga
aaagtgcaaactattggtggtgctagtgagagtgacattctggctcaggctgtcaatcaa
gctggtattgaccatagctcagcaggtaccaccatcactaccccatccatcttcaccacc
accactgctcccagcaccccccagggtgttgttactcagcctgagagtcagcccatgcca
ccacctgtttgcaatcctgaaaccctgttcatcccacgtaagaaatcccggaagacagac
tgccctaccaagatcattattaaaccacccgtgcctcccacgtccaccatgatcccagca
tcccagattaagaaagagcctgaggaattcttcaagctccagtacaaagaccaggacatc
caacccacctctggatgtattgtgatctcagacagtgaagaggaagaagacactcagact
ctaattcccacagcctcctcttcctcagagaaccagggtgtgcagctgacaatgaccacc
ccaggcagtggatcagtgggcaaaatgtctgtggagagttcctcatcctccagcagcgag
tcagagtgctgtgaagaatgtggactttcatctcccagtacgttggcatccccggtgtcc
cccattccaccacccccaccagcacccgtgatgcccagcacctctggtgccaagcccaag
ggtcccaagaccaagaccaccaggaggatcaccagcctggactgtgagagagttagaagt
gccatgaaggagaaaggtggcgtgactttcactaaccataaggtggagaccaagagaggc
agagtgaagcaagatgatgtgtcccgcatgttcaggctgaccaacaggtcactggaatac
aagaacctgcccttccaactcactaatgtccatcagattctcagtgaggctgtggctgtg
tgcaagaccatgcaagtgagcaacagaggcatcatgctgatctacactcgcacccatgaa
gttaaagaggcggtggatgctgccagaatcaggttgggtggcatctgcaacttggccatc
tccaccccattcctgatggaacacaccatgccccatgtgcacaactcagaagtcactcgc
aagaccgctgaagcctgccagcagggacttagagccgtgtgggatctgaagactgtgcaa
ccacataacttgtgccctcgctcctctgactaccgcaccatgatcattaatgcagccacc
cctgtggacttcctggcagctattcaagtcctcatccccctggcccagcagttccccaaa
caggtggccatccgtatcttctctgctgagaacaccagctcctttatgttgcccatatat
gagaatgcatccaggatgtatgctgtgggacagtttgaagagcccaaagatgaagagctt
gagaacctgagcatggccattgaggaagccatccgggatatgcaggaagactctcagtga

DBGET integrated database retrieval system