KEGG   Viruses: 25026537
Entry
25026537          CDS       T40000                                 

Gene name
UL141, CeHV-5_gp135
Definition
(RefSeq) Cercopithecine betaherpesvirus 5; membrane glycoprotein UL141
  KO
K21049  Cytomegalovirus protein UL141
Taxonomy
TAX:50292
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Cercopithecine betaherpesvirus 5)
SSDB
Motif
Pfam: UL141 CoV_S2_C
Other DBs
NCBI-GeneID: 25026537
NCBI-ProteinID: YP_004936099
RS: NC_012783
UniProt: G8XTJ5
LinkDB
Position
NC_012783:complement(172476..173579)
AA seq 367 aa
MFLRRAMVALTVLLVALTPRVKADIDYLMWDECYDSGSPAPLIMPLGSRITVPCTFLPHS
WPMISIRARFCQSEYAGYELVVNVTNGTLDTDGLTSLLHNASWKFVDMTLGHSVSLSFNI
TDNTTGMFDCLLRNETHGYMTTRFTVITQIETLHRPGEIECVPKLGLRPDGDKIWTTEYN
EWQRHNCGTFYGFDRLYYYLAATNKSNTKPPCPPNEPDRCWPVVQRYTLDGDCYRIQAPR
RRKLRPYSNQHEGGHGLRLMDVPWLTLGLTVMLIGGVCLGMVVVVRLACGECCRNYERFK
KKRRGYRPLSGQFMRAPDYDELYPSEEAFSRSYEELFDTKATDDPCPEPPLYSEVQFPLY
SEIKRRL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtttttgcgacgcgccatggtggccttgaccgtcctgttggtggccctgacgccgcgg
gtgaaggcggacatcgattacctgatgtgggacgagtgctacgacagcggctctccggca
ccgctcatcatgccgctggggtcccgcatcacggtgccctgcacctttctgcctcactcg
tggccgatgatttccatccgcgctcggttctgtcaatccgagtacgcgggttacgaactg
gtggtgaacgtcaccaacgggacgctggacactgatggactgacctcccttttgcacaat
gctagctggaaatttgtagatatgactcttggacattctgtatcgctgtctttcaatata
actgataacaccactggcatgtttgactgtttgttgcgcaacgagactcacggttacatg
accacgcggtttacggtcattacacagatagagactttgcacagacctggggagattgaa
tgtgtgcccaagttggggttgagacccgatggtgataagatctggaccactgaatacaat
gagtggcagcgccataactgtgggactttctacggctttgacaggctgtactactatttg
gccgctactaacaagtccaacaccaagccgccttgtcccccgaacgaacccgaccgttgc
tggcccgtcgtgcagcggtatactctggacggggactgctaccgcatccaggctcctcga
cgccgcaagttgcgtccttactctaatcagcatgagggcggacacggactacggttgatg
gatgtgccctggttgaccctgggactgactgtcatgctgataggaggtgtgtgtctgggc
atggtggtggtggttcgtttggcgtgcggcgagtgttgccgcaactacgagcgctttaaa
aagaagagacgcggctaccgacccctgtctggacagttcatgcgcgcgcccgactacgac
gagctgtaccccagcgaggaggcgttcagcagatcgtacgaggagctgtttgataccaaa
gctactgatgatccatgccccgagccccccttgtacagtgaagttcagttccccttgtac
agtgaaataaaaagacgcttgtaa

DBGET integrated database retrieval system