KEGG   Viruses: 25392210Help
Entry
25392210          CDS       T40000                                 

Gene name
AL387_gp043
Definition
(RefSeq) Salmon gill poxvirus; serine/threonine protein kinase; probable eukaryotic origin
Taxonomy
  Lineage
Viruses; dsDNA viruses; Poxviridae; unclassified Poxviridae
Taxonomy
Organism
vg  Viruses (Salmon gill poxvirus)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 25392210
NCBI-ProteinID: YP_009162415
RS: NC_027707
UniProt: A0A0H4Y184
LinkDB All DBs
Position
NC_027707:36828..37679
AA seq 283 aa AA seqDB search
MEYSILRSLGHGYFGKVLLVKDKENKNFAVKIQAKGSTYREIHRLEQEANIMKNLDHHFI
IKGYDFKYVNDRAWIVMEYILGKNLFEIMQKMVVCPFELSRFYLAELGMALDYLHSNKII
YRDLKPDNILININGHVKVTDFGLSKYLDTETTLGFSICGTLEYIAPEILTGVGYGFSAD
WWSYAVLAYELVTGVVPITVPDKLSLKQTLKQSVIKFPEFLPVVIMNFLTKCLVRNPIGR
PEFNEIKKMKWMSEIDFDNLSLDTPPPLNPYTLYRCGKQLIKL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaatattccattctaagaagtttaggacatggatattttggtaaagtcttgttagta
aaggacaaggaaaataaaaactttgctgtaaaaatacaggcaaaaggaagtacgtacaga
gaaattcatagactggaacaagaggccaacataatgaagaatctagatcatcattttatt
ataaaggggtatgatttcaagtacgtgaatgacagagcatggatagtcatggaatatatt
ctgggtaaaaacttatttgagatcatgcaaaaaatggtggtctgtccatttgaactgtcc
aggttttatttggctgaactaggcatggccctggattatctacatagtaataaaattata
tacagagacctgaagcctgataatattttgattaatataaacggtcatgtgaaggtcacg
gactttggtttgagtaaatatttggatacggaaaccacgttaggattcagtatatgtgga
acacttgaatatattgctcctgaaatattaactggtgtaggatatggattttctgcagat
tggtggtcgtatgctgttttagcatatgaactggtcaccggtgtcgttcccataactgtt
ccggataaactcagtcttaaacaaactcttaaacaatcggttattaaatttccggaattt
cttcctgtggtgataatgaattttttgacaaaatgtcttgtaaggaatcctatcggacgt
ccggagtttaatgaaataaaaaaaatgaagtggatgtcagagatagattttgacaattta
agtcttgacaccccacctccgttgaatccgtatacgttatacagatgtggtaagcaacta
ataaagttgtaa

DBGET integrated database retrieval system