KEGG   Viruses: 2641657
Entry
2641657           CDS       T40000                                 

Gene name
stxB1, PBV4795_ORF41
Definition
(RefSeq) Enterobacteria phage BP-4795; Shiga toxin Stx1a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:196242
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; unclassified Siphoviridae
Organism
vg  Viruses (Enterobacteria phage BP-4795)
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-GeneID: 2641657
NCBI-ProteinID: YP_001449278
RS: NC_004813
UniProt: Q6H9W3
LinkDB
Position
NC_004813:20302..20571
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system