KEGG   Viruses: 26516283
Entry
26516283          CDS       T40000                                 

Gene name
stxB, AU083_gp11
Definition
(RefSeq) Escherichia phage phi191; Shiga toxin Stx2a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Oslovirus; Escherichia virus 191
Organism
vg  Viruses (Escherichia virus 191)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 26516283
NCBI-ProteinID: YP_009187869
RS: NC_028660
UniProt: A0A096XEN1
LinkDB
Position
NC_028660:complement(8705..8974)
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system