KEGG   Viruses: 26516448
Entry
26516448          CDS       T40000                                 

Gene name
stx2B, AU085_gp41
Definition
(RefSeq) Enterobacteria phage VT2phi_272; Shiga toxin Stx2a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:936054
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Oslovirus; unclassified Oslovirus
Organism
vg  Viruses (Enterobacteria phage VT2phi_272)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 26516448
NCBI-ProteinID: YP_009187358
RS: NC_028656
UniProt: E7DYU9
LinkDB
Position
NC_028656:28496..28765
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system