KEGG   Viruses: 26519430
Entry
26519430          CDS       T40000                                 

Gene name
AU154_gp40
Definition
(RefSeq) Shigella phage Ss-VASD; Shiga toxin Stx1a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Oslovirus; Shigella virus VASD
Organism
vg  Viruses (Shigella virus VASD)
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-GeneID: 26519430
NCBI-ProteinID: YP_009190547
RS: NC_028685
UniProt: A0A0H4J3D8
LinkDB
Position
NC_028685:26483..26752
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system