KEGG   Viruses: 2952535
Entry
2952535           CDS       T40000                                 

Gene name
UL39, SuHV1_gp25
Definition
(RefSeq) Suid alphaherpesvirus 1; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:10345
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus
Organism
vg  Viruses (Suid alphaherpesvirus 1)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN DUF6401
Other DBs
NCBI-GeneID: 2952535
NCBI-ProteinID: YP_068342
RS: NC_006151
UniProt: G3G8Y3
LinkDB
Position
NC_006151:46605..48977
AA seq 790 aa
MASVVAPAASSSAAAPGADAFLDAACPEDVARALAAELEALRALGHDVGAPAPGASRREA
ALFITRAVDGLKAFSRVDERVYVACGKLVHLRVRSREADLDAWLASPELALIPAVAAAVR
RHRARVEAALRWFWREAYPALYARGLQSALKYEEMYLARLEHGRCEAMDQFFVRLAAAAA
TATRRPMALVLCGSDAWPEVFDAYFRALATQAIVPATPLMLFAGRARGSLASCYLLNPLP
RTTEEAVRAITDEVAPILLRRGGVGLSLQSFNRTPSGDCTRGIMAVLKALDSMTAAINSD
SERPTGVCVYVEPWHADVRAVLNMRGMLAADESLRCDNIFSCLWTPDLFFQRYQRHLDGE
RAVKWTLFDDRASHLASLHGPDFAREYERLERLGLGVESLPIQDMAFLIVRSAVMTGSPF
LMMKDACNRHFHTDTRGAALATSNLCTEIVQRATPGENGVCNLASVNLPACLAGGAFDFA
ALRRAARVAAVFVNAMMRIGNYPTGASVEGVRRSRSLGIGLQGLHTTVLALDMDMADPAA
RRLNAAIAEELLYGVMDASVELCERGLRPFDGFEHSRYARGVMPFDAYERVSLREPMRWD
ALRVRIAEHGVYNAQFVALMPTVSSSQVTESSEGFSPTFTNMFSKVTISGELLRPNLPLM
ETLRRLFPRECARRDAVARLERAQWSVAAAFGELPAGHPLAKFKTAFEYDQELLIDMCAD
RAPFVDHSQSMSLFLTEPADGKLHASRVMGLLMRAYNLGLKTGMYYCKIRKATNNGVFTG
GDLVCTSCHL
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggcctccgtcgtcgcgcccgccgcctcctcgtccgccgccgcccccggcgcggacgca
ttcctcgacgccgcctgccccgaggacgtcgcccgggccctcgccgccgagctcgaggcg
ctgcgcgccctcgggcacgacgtcggcgcgcccgcgcccggcgcctcgcgccgcgaggcg
gcgctgtttatcacgcgcgccgtggacgggctcaaggccttctcccgggtggacgagcgc
gtgtacgtggcctgcggcaagctggtgcacctgcgcgtgcggagccgcgaggcggacctg
gacgcctggctcgcctcgccggagctcgcgctgatccccgcggtggcggccgccgtgcgc
cggcaccgcgcgcgcgtggaggcggccctccgctggttctggcgggaggcctacccggcg
ctctacgcgcgcggcctgcagtcggcgctcaagtacgaggagatgtacctggcccgcctc
gagcacgggcgctgcgaggccatggaccagttctttgtgcgcctcgccgcggccgccgcc
acggcgacgcggcgccccatggcgctcgtgctctgcggctcggacgcgtggcccgaggtc
tttgacgcgtactttcgcgcgctggccacgcaggcgatcgtgcccgcaaccccgctcatg
ctcttcgccggccgcgcgcgcggctcgctcgccagctgctacctgctgaaccccctgccg
cgcaccaccgaggaggcggtgcgcgccatcacggacgaggtggcccccatcctgctgcgc
cgcggcggcgtcgggctctcgctgcagagcttcaaccgcacgccctcgggcgactgcacg
cgcggcatcatggccgtgctcaaggcgctggactcgatgacggcggccatcaacagcgac
agcgagcgccccacgggcgtgtgcgtgtacgtcgagccgtggcacgcggacgtgcgcgcc
gtgctgaacatgcgcggcatgctcgccgccgacgagagcctccgctgcgacaacatcttc
agctgcctctggacgccggacctgttcttccagcgctaccagcggcacctggacggcgag
cgcgccgtcaagtggacgctctttgacgaccgcgcctcgcacctggcctcgctgcacggg
cccgactttgcgcgcgagtacgagcgcctggagcgcctcggcctcggcgtcgagtccctg
cccatccaggacatggccttcctcatcgtccgcagcgccgtcatgacgggcagccccttc
ctcatgatgaaggacgcgtgcaaccggcacttccacacggacacgcgcggcgccgccctc
gccacgtccaacctctgcacggagatcgtgcagcgggccacgcccggcgagaacggcgtc
tgcaacctggccagcgtgaacctgcccgcgtgcctggcgggcggcgccttcgactttgcc
gcgctgcgccgggccgcgcgcgtcgccgccgtcttcgtcaacgccatgatgcgcatcggg
aactacccgacgggcgcctcggtcgagggcgtgcggcgcagccgctcgctgggcatcggc
ctgcagggcctgcacacgaccgtgctggcgctggacatggacatggccgacccggcggcg
cggcgcctcaacgccgccatcgccgaggagctgctctacggcgtcatggacgccagcgtg
gagctctgcgagcgcggcctgcgccccttcgacggcttcgagcacagccgctacgcgcgc
ggggtcatgccctttgacgcctacgagcgcgtctcgctccgcgagccgatgcgctgggac
gcgctgcgcgtccgcatcgcggagcacggcgtgtacaacgcgcagtttgtggcgctgatg
cccaccgtgtcctcgtcgcaggtcaccgagagcagcgagggcttctcgcccaccttcacc
aacatgttcagcaaggtcaccatctcgggggagctcctgcgccccaacctgccgctcatg
gagacgctgcggcgcctgtttccgcgcgagtgcgcgcgccgggacgccgtggcgcggctg
gagcgcgcgcagtggtccgtggccgcggccttcggggagctgcccgccgggcacccgctg
gccaagttcaagacggccttcgagtacgaccaggagctgctcatcgacatgtgcgcggac
cgcgccccctttgtggaccacagccagtccatgtccctcttcctgaccgagcccgccgac
gggaagttacacgcctcccgcgtcatgggcctcctcatgcgggcatataacctgggcctc
aagacgggcatgtactactgcaagatcaggaaggccaccaacaacggggtgttcaccggc
ggggacctggtctgcacgagctgccacctgtga

DBGET integrated database retrieval system