KEGG   Viruses: 2952673
Entry
2952673           CDS       T40000                                 

Gene name
grh164
Definition
(RefSeq) Macacine betaherpesvirus 3; rh164
  KO
K21049  Cytomegalovirus protein UL141
Taxonomy
TAX:47929
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Macacine betaherpesvirus 3)
SSDB
Motif
Pfam: UL141 FAM176
Other DBs
NCBI-GeneID: 2952673
NCBI-ProteinID: YP_068253
RS: NC_006150
UniProt: R4V8I1 Q7TFH8
LinkDB
Position
NC_006150:complement(169096..170388)
AA seq 430 aa
MSYTVRFRKGFGRVSEEAETVQLLAEGQEGADSADAESASKRTIHDGPLRVKACTPVSAP
RAAMWVRRAMVAITIVMVSLTPRVRGGSIDHTMWDECYEHNSPAPLIMPIGSQVTVPCAF
LPHSWPMVSIRARFCQSEYGGYELKINATNGTVVDDDLTYRLINASWKFHDLAISHYVTL
TMNISDNTTGMFDCVLRNATHGFLMTRFTIVTQIETLHRPGDPDCAPKLGFHADGKKIWS
AEYNEWQRHQCGTFYGFDRLYYYLAASNQSNTKPPCPPSEPDRCWPVLQQYVLDGDCFRS
QNFRREPPLPTEKTPVPIFVIDWQWVSLGLTMMVIGGVCLGLVLVVRCACGEMCRNRERF
QKKMNAYRPMSTHFMRPPGYEELYSVVDDESDSGYFEKEDRSESYNDLVDENVYDEVAVP
PLYSKIKRRL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgtcgtataccgtgcggtttcgaaaaggcttcggccgggtgagcgaggaggccgaaacc
gtgcagcttttggcggaggggcaggaaggtgcggactccgcggacgcagaatcggcttca
aaacgaactattcatgacgggccgctccgagtcaaagcctgcacgccggtatcggcgccg
cgagccgctatgtgggtgagacgcgctatggtggcgatcaccatcgtaatggtgagcctg
acgccgagggtgaggggaggcagcatagaccacacaatgtgggacgagtgctacgagcac
aattcgccggcacctctgattatgccgattgggtcccaggtgaccgtgccctgtgccttt
ctgcctcactcttggccgatggtgtctatccgcgcgcggttctgtcaatcagaatatggt
ggttatgagctgaagatcaatgccactaacgggacggtcgtggacgatgatttgacttac
cgcctgattaatgccagctggaagtttcacgatttggccatatctcattatgttaccctg
actatgaacattagtgataacactactggcatgttcgattgtgtgcttcgcaatgccact
cacggttttctcatgactaggttcaccatagtaacgcagatagagactctgcaccgaccc
ggtgatccagactgtgcgcctaagttgggattccatgccgatggtaaaaaaatctggagc
gcagagtacaatgagtggcagcgccaccagtgcggaaccttttacggtttcgacagactg
tactattacttggcagctagtaatcagtccaacaccaagccgccttgccctccgtccgag
cccgatcgatgttggcccgtgctgcaacagtatgttttggatggtgactgtttccgtagc
cagaactttcgtcgggaacccccgctgcccacagaaaaaactcctgtccctatttttgtt
atagactggcaatgggtttctctggggttgaccatgatggtgattggcggcgtgtgccta
gggctggtgctagtggttcggtgtgcgtgcggtgagatgtgcaggaaccgagaacgcttc
cagaaaaagatgaacgcctatcgacctatgtctacgcatttcatgcgtccgcctggctac
gaagagctgtactcggtcgtggatgatgagagtgatagtgggtattttgagaaggaagac
cgcagcgagtcgtacaacgacttggtggatgagaatgtgtatgatgaagttgccgtaccg
cctctgtacagcaaaataaagagacgcttgtag

DBGET integrated database retrieval system