KEGG   Viruses: 2952754
Entry
2952754           CDS       T40000                                 

Gene name
grh111
Definition
(RefSeq) Macacine betaherpesvirus 3; rh111
  KO
K21045  Cytomegalovirus tegument protein UL83
Taxonomy
TAX:47929
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Macacine betaherpesvirus 3)
SSDB
Motif
Pfam: Herpes_UL82_83 IMUP
Other DBs
NCBI-GeneID: 2952754
NCBI-ProteinID: YP_068204
RS: NC_006150
UniProt: I3WFD0 Q7TFM3
LinkDB
Position
NC_006150:complement(109552..111171)
AA seq 539 aa
MDLSQRYRLDYVSELGPIAGKVIQSVFDEAREPVKPHETKIVKTGLRVQVHRPSIIFLTQ
FARNLKPDPRYEHNTLQIKHMTFEDQELKDVYLHVHNPTDKPITPADEPMSFFLYALPLR
HLVPADLTLHPGGTYNPELPTYDAAVQAFAQGYHTRFNAYHLQWTQRYNRWMPHGVHHTA
SFYVNTSPMPLWSINVANELVCSLRSTHVRKIQLVDKVKGLVRIFLESFQEETPDDKVFI
HLAWEQSSGIITMNRNPKPFLTPQQRNGYTILNPKRLHLKPREHANVMIDTYFESDKYIG
FICPKSVPGCSISCNPIMSTQCIFMEIRSLHDSVYIEPFQAIASLHFFDRNLFFTYKKTD
HSIFRDQYRITTSFEYHQGKGVPIVQDSSEDDSSSSSESEDMDVFEVASTTPHAGTSSSA
SKKREKLYKPLVQRKRFTEDDAAKKSSSDDENDDFFPTLYWGIWQFGVRATELTPMIASV
CGDQLPHQEFSWEGDDDLRIFSGLSGSWHMYQAPKRRHYSPSEQLPSTSGESVSKRPCE
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggatctatcgcaacgttaccggctcgattatgtatccgaattggggcccatcgccggc
aaagtcatccaaagcgtgtttgatgaagcccgtgaacctgtcaaaccgcacgaaaccaag
attgtcaaaacaggccttcgtgtccaggtccatcggccgtccatcatctttctcacacag
ttcgctcgaaatctgaaaccagatcctcgctacgaacacaatactcttcaaattaaacac
atgacgtttgaggaccaagaattgaaagatgtttatttgcatgtacacaatcctactgac
aaacccattacgcccgcggacgaaccgatgtccttttttctctatgccctgccgctcaga
cacctcgtacccgccgacctaacactccatccaggcggtacgtataatcccgagttaccc
acttacgatgccgctgtccaggcgtttgcccaagggtatcatacccgtttcaacgcgtat
cacctccaatggacccaaagatacaaccgctggatgccacacggcgtgcaccacaccgca
tcattttatgtcaatacaagccccatgccgctgtggagcataaacgtcgcaaatgaactg
gtgtgctccctgcgcagtacacacgttagaaaaatccaacttgtcgataaagtgaaagga
ctggtacgaatcttcttggaatctttccaagaagaaaccccagacgacaaagtgtttatt
catctcgcctgggaacaaagcagcggtattatcactatgaaccgcaaccccaagcccttc
cttacgccgcaacaaaggaacggctacactattctaaatcccaaaagactccacttgaaa
cccagagaacacgccaacgtcatgatcgatacatactttgagtcagacaagtatattggc
tttatttgccccaaaagcgttcccggatgcagtatatcatgcaacccgattatgtccaca
cagtgtatctttatggaaatcagaagcctgcacgacagtgtgtatatcgagccgttccag
gccatagcctcgcttcactttttcgatcgtaacttgttttttacgtataaaaaaaccgat
cattccatttttagagatcaataccgcatcacgaccagttttgaataccatcagggcaaa
ggcgttcctattgtccaagactccagcgaagatgattccagctcatcctccgaatcggag
gatatggacgtcttcgaggtcgcatccaccacaccacacgccggaacatcatcctccgca
tctaaaaagcgcgagaaactttacaaaccgctcgtccagcgcaaacgttttaccgaggac
gacgcggcaaagaaaagcagctccgacgacgaaaatgacgactttttccccactttgtac
tggggaatatggcaatttggcgtccgcgctacagaattaactcccatgatagccagcgtg
tgcggcgatcaactacctcaccaagaattctcctgggaaggcgacgacgacctccggatc
ttctcaggcctctcgggttcttggcacatgtatcaagcccccaaacgtcgccactactca
ccttccgagcagctaccgtctaccagtggcgagtcggttagcaaaaggccctgtgaatag

DBGET integrated database retrieval system