KEGG   Viruses: 2952777
Entry
2952777           CDS       T40000                                 

Gene name
grh112
Definition
(RefSeq) Macacine betaherpesvirus 3; rh112
  KO
K21045  Cytomegalovirus tegument protein UL83
Taxonomy
TAX:47929
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Macacine betaherpesvirus 3)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 2952777
NCBI-ProteinID: YP_068205
RS: NC_006150
UniProt: Q91CJ4 Q772N2
LinkDB
Position
NC_006150:complement(111240..112868)
AA seq 542 aa
MASRPHRFPDLVTDLGPTSGHLVKLIFNANKEHLNPHTTYIADTHLNVRVNQPSVILATQ
FTPESQPCQRYDTNLQIKHTAFEPRSLEPLVVHVHNPTDRPIPTTAEPLSMYVYALPLDP
VTPPELILRQGESHKRRTTVADAVVQQIDDKKWHTRLTASRLVWSRNQSRYTANSVYHTT
SFIFNSQQMPLGSMNTASELVCSIPHTHVTNIRKISKDEVKVYLECLQEDTPETKCFVHL
AWENGNHDIVMNRNPKPYLRAHDRNGFTILCPQTLHLKPGKTSHLMFDVCFESDKYVAII
CPRTIPGISMSCNPLLPLQNLFMEIKAVHESLYIEQYEELGWLYFFDRKMILTKGTATEP
AQARLVDQHRLMAKLEYHHVYGDQADDESGSSASDSDMEVFRHPPSGSSARRPSQPPASS
SRKPSSSAASSTMTTRSKHRVTKAETSDESEEDDDDRETLVFSWPNWQCGIKSTSLVPIV
ASAHGDRLPYQDFPWGEGDDYRTFSGIEIDLQPYQTQRRRRHTRLEPIPESCTVSVPKKH
RS
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggcctcgcgaccgcatcggtttcccgatttggtaaccgatctcggcccgacgtcgggc
caccttgtcaaactcattttcaatgccaacaaagaacacttgaatccgcacaccacctac
atcgcggacacacatctcaatgtcagagtcaatcagccatcagtcattctagccacacag
tttacgcccgaatcgcagccttgtcagcgctatgacacaaaccttcagatcaaacatacg
gccttcgagccccgaagtttggaaccgcttgtcgtacatgtacacaacccaaccgaccga
cccattccaaccaccgccgaaccgctgtctatgtacgtgtatgccttgccgctagatcct
gtcacccctcccgagctcatcctacgccagggagaaagtcacaagcgccgcaccacggtc
gccgacgccgtggtacaacagattgatgacaaaaaatggcacacccgactcactgcctcc
cgtctggtgtggagccgaaatcagagtcgatacacagccaacagcgtttatcacactaca
tcgtttattttcaatagtcaacagatgccgctgggctctatgaatacagccagcgagctc
gtttgctcgataccgcacacacacgtgacgaacattcggaaaataagcaaggatgaagtt
aaggtttatctggaatgccttcaggaagatactcccgaaacaaaatgcttcgttcatctc
gcttgggagaacggcaatcatgacatcgtgatgaatcgcaaccccaaaccgtatctgagg
gcacatgacagaaacggatttaccattctgtgtccgcagacgcttcatttgaagccgggg
aaaacctcacacctcatgttcgacgtttgtttcgagtctgacaagtatgtcgccatcatc
tgtcccagaaccatcccgggaatcagcatgtcgtgtaacccactattgccgctacaaaac
ttgtttatggagattaaagccgttcacgagagcctgtacatcgaacagtacgaagaactt
ggctggttgtactttttcgatcgcaaaatgattctcaccaagggtaccgccacagaacct
gcccaggcgcgtttggtcgaccagcatcgcctaatggccaaactggaataccatcacgtg
tacggcgaccaggccgacgatgaaagcggctcctccgcctcagactccgacatggaggtt
ttccgccatccgcccagtggtagttctgcgcgacgaccatctcagccgccagccagcagc
agcagaaaaccatcgtcctcggcggcatcgtccaccatgacgacgcgcagcaaacatcgc
gtcaccaaggccgaaacgagcgacgagtcagaagaagacgatgacgaccgcgaaacactc
gttttctcgtggccaaactggcaatgcggcatcaaatccacgagcttggttcccattgtg
gctagcgcccacggcgacagactaccctaccaagatttcccctggggagaaggcgatgac
tatcgcactttttcgggtatagaaatcgatctccagccctatcaaacacaaagacgccgt
cgccacacgcgccttgaacccattccagagtcgtgcacggtttcggttcctaaaaagcac
cgtagttag

DBGET integrated database retrieval system