KEGG   Viruses: 2952807
Entry
2952807           CDS       T40000                                 

Gene name
grh60
Definition
(RefSeq) Macacine betaherpesvirus 3; rh60
  KO
K22788  Cytomegalovirus viral inhibitor of caspase-8-induced apoptosis
Taxonomy
TAX:47929
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Macacine betaherpesvirus 3)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 2952807
NCBI-ProteinID: YP_068154
RS: NC_006150
UniProt: Q7TFS1
LinkDB
Position
NC_006150:complement(47988..49151)
AA seq 387 aa
MEPFGVVELSKLGFYQLVMMIGRSGAIYCYEETEKCVYCLAPDMKSFIQLGLRRCDYLQK
MELYQEPVIDCDEIIKELMIFNWDVDRISDVVAKNGYRVYDIRDPLGEQVDSHFALWSSD
SAVANFQDTSFSLMSPSGLRSFEIMVRCVARIVCVNQLLGVLGCFRKEKNEFLVRLYVLV
DKFGTIYGFDPALNSIYRLAENMRMFTCMMGKKGYRNHRHDRRRTAIVRLEKVPYCMHGE
EPSDPMIMFNDDSEDEKPPKTEADVVVGIYEAIKADIRFGVDMMMRDSSVTQKFWPQHLE
ALSDSPLLPSLIYDMEDVRSKMLGNIADMRAFDMSFVGLAEDNDSDREETVRGYLFDDTV
CTRCVSSRRLRLFRSGRGMGRARVSYV
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggagccgtttggagtggtggagctttcgaagctaggcttctaccagctcgtcatgatg
atcggtcgaagcggtgctatctactgttatgaagaaaccgaaaagtgcgtgtattgtttg
gcacctgacatgaagtccttcatccaactcggactacgtcgttgcgactatctccaaaaa
atggagctgtatcaggaacctgtgattgactgtgatgaaattataaaggagcttatgatc
ttcaactgggatgtggacagaatatcggacgtggttgcgaagaacggttaccgcgtctac
gatattagggatcccctgggtgaacaagtagacagtcattttgccttgtggtccagtgac
agcgcagtggccaattttcaagacacttcttttagtctcatgtcaccttcagggctgcgc
tcctttgaaatcatggtgcgttgcgtggctcgtatagtgtgtgttaatcaattgctcggg
gtgctaggttgcttccgtaaagaaaaaaatgagttcctagtcagactctatgtactagtt
gacaagttcggtacaatttatggctttgatcccgccctaaactccatctatcgcttagct
gagaatatgcgaatgtttacctgcatgatgggaaaaaagggttaccggaatcacagacac
gataggagacgcacagctatcgttaggttggaaaaggtcccgtattgcatgcacggtgaa
gaacccagtgatcctatgatcatgttcaatgatgacagtgaagacgaaaaaccgcccaaa
acggaggccgatgtcgttgtgggcatttatgaagccataaaagccgatatcagatttggc
gtggacatgatgatgcgggactcgtctgtcactcaaaagttctggcctcagcatctcgaa
gccctttccgattcacctttgctaccttctctgatctacgatatggaagatgttagatca
aaaatgctcggcaatattgcggacatgcgagcttttgacatgtcgttcgttggactcgca
gaggacaacgattcagaccgcgaagaaacagtccgaggatatctttttgacgacactgtg
tgcacgcggtgtgtgtctagtcggcgcctccgactgtttcgctccggacgcggaatgggt
cgtgctagagtttcctatgtgtaa

DBGET integrated database retrieval system