KEGG   Viruses: 2952809
Entry
2952809           CDS       T40000                                 

Gene name
grh64
Definition
(RefSeq) Macacine betaherpesvirus 3; rh64
  KO
K22776  Cytomegalovirus apoptosis inhibitor UL38
Taxonomy
TAX:47929
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Macacine betaherpesvirus 3)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 2952809
NCBI-ProteinID: YP_068158
RS: NC_006150
UniProt: I3WF60 Q7TFR7
LinkDB
Position
NC_006150:complement(50702..51583)
AA seq 293 aa
MATSAEYDQEQRMQQNQMDIGSLIQASVLGKTALRAQVKKLMARETHIKHEFGVTVCICD
HTYTFLGINLCKISWLERNCPPLSHALTMFGVIEAWDEAAPRPSRQVVLFMSDNYDIYAY
DTGILFFMAPTMSEFWTAPIVLEYWNGIFPLEVRHRVRQYAKSVDDLIVIFNQVYHQRDV
LEARRQKNQNSPRTFARFLCGYVRALLDAERRVREGKIPVPFVDRDSLMANVIPVTLPTP
SVQEPERGVDSKKALTRQCSLPTPNPKKVNAHPDDSDSDESIVDLTMEGAASL
NT seq 882 nt   +upstreamnt  +downstreamnt
atggctacttctgcagaatacgatcaggaacagaggatgcaacagaatcagatggacata
ggcagtctcattcaggcttctgtgttgggcaagacggcgctcagggctcaagtgaagaag
ctcatggcgcgtgaaacacatattaagcatgaatttggtgttaccgtgtgcatatgtgat
catacgtacacgtttttgggaattaacctttgtaaaatcagttggctggagcgcaattgt
ccgcccctgagtcatgccttaactatgtttggagttatcgaggcttgggacgaggctgct
cctcgaccttccagacaggtggtgctgtttatgagtgataactatgacatttacgcctat
gatactggaatcctgttcttcatggcacctaccatgtccgagttttggacagctcccatc
gttttggagtactggaatggcatctttcccttagaagtcaggcaccgggttaggcagtat
gccaaatctgtggacgatctcattgtgattttcaaccaggtgtaccaccagcgagacgtg
ttggaagcccgcagacagaagaatcagaacagtcctcggacgtttgccagatttctctgc
ggttatgtgcgagccctgctggacgccgaaagacgcgttcgggagggcaagattccggtg
ccgttcgtggatagagatagcctgatggccaacgtgattcccgtaactcttccgactccg
agtgtccaagagcctgagaggggcgtggacagtaaaaaggcactgactcggcagtgttcg
ctccctacccctaatccgaaaaaggttaacgcacatcctgacgactctgatagtgatgag
tctattgtggacctgacgatggagggcgctgcatctctgtaa

DBGET integrated database retrieval system