KEGG   Viruses: 2952811
Entry
2952811           CDS       T40000                                 

Gene name
grh89
Definition
(RefSeq) Macacine betaherpesvirus 3; rh89
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
TAX:47929
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Macacine betaherpesvirus 3)
SSDB
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 MFS_1 DUF5850 Phage_holin_3_6 DUF4763
Other DBs
NCBI-GeneID: 2952811
NCBI-ProteinID: YP_068182
RS: NC_006150
UniProt: Q7TFP5
LinkDB
Position
NC_006150:complement(77687..80071)
AA seq 794 aa
MSKFPYRVCSMAQGTDLLRFEQNINCDSFKPTKEDFEEGIMVVYKRDIRPYTFKVHMYQK
ILTFRQSYSFIRENHLLGFSQEHLAVPMWEVHYINKLNRCYNSVVRNVAGATYVNYHRDS
YVNETMLLVEDDFSNTHSSRFVTVKELWHKPGSTWLYTTSCNVNCMVTVTTARSKYPYDF
FVTSDGKVVDISPFYNGSNNKHFGENRDKFSVRKNYSMIAYYGRDNAPEVAHPLVGFFER
PDVLMSWDIVEEANNTCEYTFWEQSERTIRSEADDTYHYTSSSMTATFLTSKEELNESDP
SFQCIKDKANEQLQLIFNTSYNETYVQSGNVSMYETTGGLIVFWLPVKEKSILEMEELAV
AYNNTNSSTRRKRSTDSASDSNKTSEEVLKSIVYAQLQYTYDTLRNYINRALRQIAEAWC
KDQKRTLEVFKELSKINPSAMLSAIYDKPIAARFVGDVISLAQCVEVDQNSVKVLRDMRT
KECGVCYSRPVVLYTFKNSSHVQYGQLGEYNEILLGRHRTEACEYPSLKIYIAGNSSYEY
VDYLYKRMIPLDSISTVDTMISLDIDPLENTDFKALELYSEDELRSSNVFDLEDIMREFN
TYKQRMIHVEGKVFDKVPGYLRGLDDMMSGLGSAGKALGVAIGAVGGAVASFVEGVVGFI
KNPFGSFTVILFLLAVLGVIYLIYMRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQY
ENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNR
RRGGYQKIQNEYEV
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgtccaaatttccgtatcgtgtttgctcaatggcccagggaacggatcttcttcgattt
gagcagaacattaattgtgatagtttcaaacctacgaaagaagattttgaagaaggtatt
atggtggtttacaaacgtgatattcggccatacactttcaaagtgcatatgtatcaaaaa
attttgacatttcgccagagctattctttcatcagagaaaatcatttgttgggatttagt
caagagcatctagccgtaccaatgtgggaagttcattacattaataaattgaatagatgt
tacaattccgtggtcaggaatgtggcaggtgctacttatgtaaattatcacagggacagt
tatgtgaatgaaactatgcttctggttgaggatgatttctccaatactcatagttcccgc
tttgtgactgtgaaagaactttggcacaaacctggcagtacctggctgtatactacaagt
tgtaatgtaaattgcatggtgaccgtaactacagctagatctaagtacccctatgacttt
tttgtgacttctgatggtaaagttgtggacatttctcctttttacaatggatctaacaat
aagcattttggagaaaaccgtgacaaattttccgtcagaaagaactattctatgattgcg
tactatggaagagacaatgctccagaagttgcgcatccgcttgtgggtttttttgaacgg
ccagatgtgcttatgtcgtgggatattgttgaggaagctaataatacctgtgaatacacg
ttttgggaacaatcagaacgcacaattagatcggaggctgatgatacctatcattataca
tctagcagtatgacggccacctttttaacttcaaaagaggaactaaatgagtctgatcct
tcttttcaatgtattaaggataaagctaatgagcagttacaactaatttttaatacatct
tataacgagacatatgtacaatctggaaatgtttctatgtatgaaaccactggtggattg
attgtgttttggttacctgtaaaagaaaaatcgattcttgagatggaggaattggctgta
gcttacaacaataccaacagtagtactcgtagaaaacgttctactgattccgcatcggac
tctaacaaaacctcagaagaagttctaaaaagcatagtgtatgctcaattgcagtacact
tatgatacattgagaaattacattaaccgtgctctcaggcaaatcgctgaagcatggtgt
aaagatcagaagagaacattggaagtgttcaaagaactcagcaaaatcaatcccagtgct
atgctgtctgccatttacgataaaccgattgccgctcgatttgttggagatgttatcagt
cttgctcagtgtgtggaggtggatcagaacagtgtcaaagtgctacgtgatatgcgtaca
aaggaatgtggtgtttgctattctcggccggttgtgctgtacacttttaaaaacagttct
catgtccagtatggccagcttggtgaatataatgaaattttgcttggacgccatcgtaca
gaggcgtgtgaataccccagtttgaaaatttatattgctggtaattcgtcttacgaatat
gttgactatctgtacaaaagaatgattccactggacagcatttccaccgtagacaccatg
atttctctggacattgatccgctggaaaacaccgatttcaaagctttggaactgtactct
gaggacgaattacggtctagtaatgtgtttgatttggaagacatcatgcgagagttcaat
acgtacaagcagagaatgattcacgtggaaggaaaggtgttcgacaaagtgcctggatat
cttcgtggtctggatgatatgatgagcggtctaggttctgcagggaaggctttgggtgtg
gccatcggagctgtcggtggtgctgtggcttcttttgtggaaggtgtcgtcggtttcatc
aagaatcccttcggttctttcactgtgattctctttttgcttgcggtactgggtgttatt
tacttgatctacatgcggcaaaagcgcgcgtacgagaagcccttcgagcactttttcccg
tatgtcgttccaccaaccacggtaaaggaagctccgccttcgtatgaacaaagccagtat
gaaaacataaaagagaaagcagcctccgcaaccaaggaattcagtttagaggaggcctat
cagatgcttttggctttgcaaaaactggatcaagaaaaacgcagaaaggcagaagcggat
gacgaagatttcgcatcgaacggtcaatccgccggcttcttggaccgcttgcgcaacaga
cggcgagggggctaccaaaagattcagaacgagtacgaggtgtga

DBGET integrated database retrieval system