KEGG   Viruses: 2952832
Entry
2952832           CDS       T40000                                 

Gene name
grh56
Definition
(RefSeq) Macacine betaherpesvirus 3; rh56
  KO
K22782  Cytomegalovirus G-protein coupled receptor UL33
Taxonomy
TAX:47929
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Macacine betaherpesvirus 3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv DUF2207 CitMHS
Other DBs
NCBI-GeneID: 2952832
NCBI-ProteinID: YP_068150
RS: NC_006150
UniProt: Q7TFS5 Q80QU1
LinkDB
Position
NC_006150:43983..44972
AA seq 329 aa
MTNLYSANFLTLIVLPFIVLSNQHLLPASAVTCKFLSLLYYSSCSVGFATVALIAADRYR
VIHRRTQARQSYRNTYMIVGLTWLIGLICATPGGVYTTIVAHRDGESDAQRHNTCIMHFA
YDEVYVLMVWKLLIVLVWGIVPVVMMSWFYAFFYNTVQRTAKKQQRTLKFVKVLLLSFII
IQTPYVSIMIFNTYATVGWPMECADLTRRRVINTFSRLVPNLHCMVNPILYALMGNDFVS
KVGQCFRGELTNRRTFLRSKQQARNSDDVPTIVSQQPATPTIVNKPEKNPHVKRGVSFSV
SASSELAAAKKAKDKAKRLSMSHQNLRLT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaccaatctttactctgccaattttctcaccttgatagtacttccttttatcgtttta
agcaatcaacaccttttacctgccagtgcagtaacctgtaaatttctctccctgttgtac
tactctagctgcagcgtaggttttgctacagtggcactgatagcggccgaccgataccga
gtgattcatcgccgaactcaagctcgccaatcctaccgtaacacatatatgatagtaggc
ttaacgtggctcattggcttgatctgcgctacccccgggggggtctacacaaccattgta
gctcaccgcgatggggaaagtgatgctcaaagacacaatacttgcattatgcactttgcg
tatgatgaagtttacgtcctcatggtctggaaacttctcatcgttttagtctggggcata
gtgccagttgtcatgatgagctggttttacgcgtttttttacaatactgtacaaagaaca
gccaaaaaacaacaacgtacgttgaaattcgtaaaggtattactcctgtcattcatcatc
atccaaactccctatgtgtcaatcatgatttttaacacgtatgccaccgtaggatggccg
atggaatgcgccgatctaactagacgccgagtcatcaacacgttttcccgtctcgtcccc
aatctacattgcatggtcaaccccatcctctacgctctcatgggaaatgactttgtgtct
aaagtgggccaatgctttcggggggaactcacgaaccgtcgaacttttctgcgttccaag
caacaagcccgcaactcggacgatgtaccgacaattgtcagtcaacaacccgccacaccc
accatcgtcaataagcccgaaaaaaacccgcacgtaaaacgcggtgtatctttcagcgtc
agcgcatcttccgaactcgcagcggccaaaaaagccaaagacaaagccaagcggctttcc
atgtcccaccaaaacctacgtctgacgtga

DBGET integrated database retrieval system