KEGG   Viruses: 3077418
Entry
3077418           CDS       T40000                                 

Gene name
UL141, HHV5wtgp121
Definition
(RefSeq) Human betaherpesvirus 5; membrane glycoprotein UL141
  KO
K21049  Cytomegalovirus protein UL141
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: UL141 V-set Ig_3 PDR_assoc Izumo-Ig
Other DBs
NCBI-GeneID: 3077418
NCBI-ProteinID: YP_081575
RS: NC_006273
UniProt: Q6RJQ3 D2K3T5
LinkDB
Structure
PDB: 
4I9X 4JM0

Position
NC_006273:complement(184396..185412)
AA seq 338 aa
MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATADIAEKMWAENYETTSPAPVLVAEG
EQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKGHRLMNGLQYRLPYATWNFSQ
LHLGQIFSLTFNVSTDTAGMYECVLRNYSHGLIMQRFVILTQLETLSRPDEPCCTPALGR
YSLGDQIWSPTPWRLRNHDCGMYRGFQRNYFYIGRADAEDCWKPACPDEEPDRCWTVIQR
YRLPGDCYRSQPHPPKFLPVTPAPPADIDTGMSPWATRGIAAFLGFWSIFTVCFLCYLCY
LQCCGRWCPTPGRGRRGGEGYRRLPTYDSYPGVKKMKR
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgtgccgccgggagtcgctccgaactctgccgtggctgttctgggtgctgttgagctgc
ccgcgactcctcgaatattcttcctcttcgttccccttcgccaccgctgacatcgccgaa
aagatgtgggccgagaactatgagaccacgtcgccggcgccggtgttggtcgccgaggga
gagcaagttaccatcccctgcacggtcatgacacactcctggcccatggtttccattcgc
gcacgtttctgtcgttcccacgacggcagcgacgagctcatcctggacgccgtcaaaggc
cataggctgatgaatggacttcaataccgcctgccgtacgccacttggaatttctcgcag
ttgcatctcggccaaatattctcgctgactttcaacgtatcgacggacacggccggcatg
tacgaatgcgtgctgcgcaactatagccacggcctcatcatgcaacgcttcgtaattctg
acgcaactggagacgctcagccggcccgacgaaccttgctgcacgccggcgttaggtcgc
tactcgctgggagaccagatctggtcgccgacgccctggcgtctacggaatcacgactgc
gggatgtaccgcggttttcaacgcaactacttctatatcggccgcgccgacgccgaggat
tgctggaaacccgcatgtccggacgaggaacccgaccgctgttggacagtgatacagcgt
taccggctccccggcgactgctaccgttcgcagccacacccgccgaaatttttaccggtg
acgccagcaccgccggccgacatagacaccgggatgtctccctgggccactcggggaatc
gcggcatttttgggattttggagtattttcaccgtatgtttcctatgctacctgtgttac
ctgcagtgctgtggacgctggtgccccacgccgggaaggggacgacgaggcggtgagggc
tatcgacgcctaccgacttacgatagttaccccggtgttaaaaagatgaagaggtga

DBGET integrated database retrieval system