KEGG   Viruses: 3077424
Entry
3077424           CDS       T40000                                 

Gene name
UL55, HHV5wtgp060
Definition
(RefSeq) Human betaherpesvirus 5; envelope glycoprotein B
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 HCMVantigenic_N RCR DUF4848 DUF4763
Other DBs
NCBI-GeneID: 3077424
NCBI-ProteinID: YP_081514
RS: NC_006273
UniProt: F5HB53 C8CPF6
LinkDB
Structure
PDB: 
4OSN 4OT1 5CXF 5C6T

Position
NC_006273:complement(82066..84789)
AA seq 907 aa
MESRIWCLVVCVNLCIVCLGAAVSSSSTRGTSATHSHHSSHTTSAAHSRSGSVSQRVTSS
QTVSHGVNETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDLIRFERNIVCTSMKPINED
LDEGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIHTTYLLGSNTEYVAPPMWEIHHIN
SHSQCYSSYSRVIAGTVFVAYHRDSYENKTMQLMPDDYSNTHSTRYVTVKDQWHSRGSTW
LYRETCNLNCMVTITTARSKYPYHFFATSTGDVVDISPFYNGTNRNASYFGENADKFFIF
PNYTIVSDFGRPNSALETHRLVAFLERADSVISWDIQDEKNVTCQLTFWEASERTIRSEA
EDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSV
FETTGGLVVFWQGIKQKSLVELERLANRSSLNLTHNRTKRSTDGNNATHLSNMESVHNLV
YAQLQFTYDTLRGYINRALAQIAEAWCVDQRRTLEVFKELSKINPSAILSAIYNKPIAAR
FMGDVLGLASCVTINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNE
ILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRMIDLSSISTVDSMIALDIDPLENTD
FRVLELYSQKELRSSNVFDLEEIMREFNSYKQRVKYVEDKVVDPLPPYLKGLDDLMSGLG
AAGKAVGVAIGAVGGAVASVVEGVATFLKNPFGAFTIILVAIAVVIITYLIYTRQRRLCT
QPLQNLFPYLVSADGTTVTSGSTKDTSLQAPPSYEESVYNSGRKGPGPPSSDASTAAPPY
TNEQAYQMLLALARLDAEQRAQQNGTDSLDGRTGTQDKGQKPNLLDRLRHRKNGYRHLKD
SDEEENV
NT seq 2724 nt   +upstreamnt  +downstreamnt
atggaatccaggatctggtgcctggtagtctgcgttaacttgtgtatcgtctgtctgggt
gctgcggtttcctcatcttctactcgtggaacttctgctactcacagtcaccattcctct
catacgacgtctgctgctcactctcgatccggttcagtctctcaacgcgtaacttcttcc
caaacggtcagccatggtgttaacgagaccatctacaacactaccctcaagtacggagat
gtggtgggggtcaataccaccaagtacccctatcgcgtgtgttctatggcccagggtacg
gatcttattcgctttgaacgtaatatcgtctgcacctcgatgaagcccatcaatgaagac
ctggacgagggcatcatggtggtctacaaacgcaacatcgtcgcgcacacctttaaggta
cgagtctaccagaaggttttgacgtttcgtcgtagctacgcttacatccacaccacttat
ctgctgggcagcaacacggaatacgtggcgcctcctatgtgggagattcatcatatcaac
agccacagtcagtgctacagttcctacagccgcgttatagcaggcacggttttcgtggct
tatcatagggacagctatgaaaacaaaaccatgcaattaatgcccgacgattattccaac
acccacagtacccgttacgtgacggtcaaggatcaatggcacagccgcggcagcacctgg
ctctatcgtgagacctgtaatctgaattgtatggtgaccatcactactgcgcgctccaaa
tatccttatcattttttcgccacttccacgggtgacgtggttgacatttctcctttctac
aacggaaccaatcgcaatgccagctactttggagaaaacgccgacaagtttttcattttt
ccgaactacactatcgtctccgactttggaagaccgaattctgcgttagagacccacagg
ttggtggcttttcttgaacgtgcggactcggtgatctcctgggatatacaggacgaaaag
aatgtcacttgtcaactcactttctgggaagcctcggaacgcaccattcgttccgaagcc
gaggactcgtatcacttttcttctgccaaaatgaccgccactttcttatctaagaagcaa
gaggtgaacatgtccgactctgcgctggactgcgtacgtgatgaggctataaataagtta
cagcagattttcaatacttcatacaatcaaacatatgaaaaatatggaaacgtgtccgtc
tttgaaaccactggtggtttggtagtgttctggcaaggtatcaagcaaaaatctctggtg
gaactcgaacgtttggccaaccgctccagtctgaatcttactcataatagaaccaaaaga
agtacagatggcaacaatgcaactcatttatccaacatggaatcggtgcacaatctggtc
tacgcccagctgcagttcacctatgacacgttgcgcggttacatcaaccgggcgctggcg
caaatcgcagaagcctggtgtgtggatcaacggcgcaccctagaggtcttcaaggaactc
agcaagatcaacccgtcagccattctctcggccatttacaacaaaccgattgccgcgcgt
ttcatgggtgatgtcttgggcctggccagctgcgtgaccatcaaccaaaccagcgtcaag
gtgctgcgtgatatgaacgtgaaggagtcgccaggacgctgctactcacgacccgtggtc
atctttaatttcgccaacagctcgtacgtgcagtacggtcaactgggcgaggacaacgaa
atcctgttgggcaaccaccgcactgaggaatgtcagcttcccagcctcaagatcttcatc
gccgggaactcggcctacgagtacgtggactacctcttcaaacgcatgattgacctcagc
agtatctccaccgtcgacagcatgatcgccctggatatcgacccgctggaaaataccgac
ttcagggtactggaactttactcgcagaaagagctgcgttccagcaacgtttttgacctc
gaagagatcatgcgcgaattcaactcgtacaagcagcgggtaaagtacgtggaggacaag
gtagtcgacccgctaccgccctacctcaagggtctggacgacctcatgagcggcctgggc
gccgcgggaaaggccgttggcgtagccattggggccgtgggtggcgcggtggcctccgtg
gtcgaaggcgttgccaccttcctcaaaaaccccttcggagcgttcaccatcatcctcgtg
gccatagctgtagtcattatcacttatttgatctatactcgacagcggcgtttgtgcacg
cagccgctgcagaacctctttccctatctggtgtccgccgacgggaccaccgtgacgtcg
ggcagcaccaaagacacgtcgttacaggctccgccttcctacgaggaaagtgtttataat
tctggtcgcaaaggaccgggaccaccgtcgtctgatgcatccacggcggctccgccttac
accaacgagcaggcttaccagatgcttctggccctggcccgtctggacgcagagcagcga
gcgcagcagaacggtacagattctttggacggacggactggcacgcaggacaagggacag
aagcccaacctactagaccgactgcgacatcgcaaaaacggctaccgacacttgaaagac
tctgacgaagaagagaacgtctga

DBGET integrated database retrieval system