KEGG   Viruses: 3077442
Entry
3077442           CDS       T40000                                 

Gene name
UL36, HHV5wtgp041
Definition
(RefSeq) Human betaherpesvirus 5; tegument protein vICA
  KO
K22788  Cytomegalovirus viral inhibitor of caspase-8-induced apoptosis
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 3077442
NCBI-ProteinID: YP_081495
RS: NC_006273
UniProt: F5HAY6 C8CPD7
LinkDB
Position
NC_006273:complement(join(48595..49823,49927..50128))
AA seq 476 aa
MDDLRDTLMAYGCIAIRAGDFNGLNDFLEQECGTRLHVAWPERCFIQLRSRSALGPFVGK
MGTVCSQGAYVCCQEYLHPFGFVEGPGFMRYQLIVLIGQRGGIYCYDDLRDCIYELAPTM
KDFLRHGFRHCDHFHTMRDYQRPMVQYDDYWNAVMLYRGDVESLSAEVTKRGYASYSIDD
PFDECPDTHFAFWTHNTEVMKFKETSFSVVRAGGSIQTMELMIRTVPRITCYHQLLGALG
HEVPERKEFLVRQYVLVDTFGVVYGYDPAMDAVYRLAEDVVMFTCVMGKKGHRNHRFSGR
REAIVRLEKTPTCQHPKKTPDPMIMFDEDDDDELSLPRNVMTHEEAESRLYDAITENLMH
CVKLVTTDSPLATHLWPQELQALCDSPALSLCTDDVEGVRQKLRARTGSLHHFELSYRFH
DEDPETYMGFLWDIPSCDRCVRRRRFKVCDVGRRHIIPGAANGMPPLTPPHAYMNN
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggacgacctacgggacacgctgatggcctacggctgcatcgccatccgagccggggac
ttcaacggtctcaacgactttctggagcaggaatgcggcacccggctgcacgtggcctgg
cccgaacgctgcttcatccagctccgttcgcgcagcgccctggggcccttcgtgggcaag
atgggcaccgtctgttcgcaaggtgcttacgtctgctgtcaggagtacctgcaccccttt
ggcttcgtcgagggtccgggctttatgcgctaccaactcatcgtgctcatcgggcagcgc
ggcggcatctactgctacgatgacctgcgcgactgcatctacgagctggcgcccaccatg
aaggattttctgcggcatggctttcgtcactgcgaccacttccacactatgcgcgactac
cagcggcccatggtgcagtatgacgactactggaacgccgttatgctctaccgcggcgac
gtggagagcctgtcggccgaggtgaccaagcggggctacgcttcctacagcatcgacgac
cctttcgatgagtgtcccgacacccatttcgccttctggacccacaacacagaggttatg
aagttcaaggaaacatctttcagcgtcgtccgcgcgggcggcagcatccagaccatggag
ctcatgatccgtaccgtgccgcgcatcacctgttaccaccagttgttgggcgcgctgggc
cacgaggtgccagaacgcaaagagttcctcgtacgccagtacgtcttggtggacactttc
ggcgtcgtctacggctacgaccccgccatggacgccgtctaccgtctggccgaggacgtg
gttatgttcacctgcgtcatgggaaagaagggacaccgaaaccaccgtttcagcggccgg
cgtgaggccatcgtgcgtctggaaaagacacccacctgtcaacatcccaaaaaaacccct
gaccccatgatcatgtttgacgaggatgacgacgacgagctgtcgctgcctcgaaacgtg
atgacgcacgaggaggccgagagtcgcctgtacgacgccatcaccgagaacctgatgcac
tgcgtcaaactggtgacgacggactcgcccctggctacgcacctgtggccgcaggagctt
caggccctgtgtgacagcccagcactgtcgctgtgcaccgatgacgtggagggtgttcgc
cagaagctgcgagctcggacgggctcgttgcaccactttgaactctcttaccgctttcac
gacgaggaccccgagacctacatgggcttcctctgggatatcccgtcctgcgaccgctgc
gtgcgccgacggcgtttcaaggtgtgcgacgtcggtcgacggcacattattcccggcgcc
gccaacggcatgccgcccctcaccccgccacacgcctacatgaacaactga

DBGET integrated database retrieval system