KEGG   Viruses: 3077464
Entry
3077464           CDS       T40000                                 

Gene name
UL16, HHV5wtgp021
Definition
(RefSeq) Human betaherpesvirus 5; membrane glycoprotein UL16
  KO
K21043  HCMV immunoevasion protein
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: UL16 Baculo_LEF-2
Other DBs
NCBI-GeneID: 3077464
NCBI-ProteinID: YP_081475
RS: NC_006273
UniProt: F5HG68 Q7TF85 B9VXI7
LinkDB
Structure
PDB: 
2WY3

Position
NC_006273:22754..23446
AA seq 230 aa
MERRRGTVPLGWVFFVLCLSASSPCAVDLGSKSSNSTCRLNVTELASIHPGETWTLHGMC
ISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVP
VTKLYTSRMVTNLTVGRYDCLRCENGTMKIIERLYVRLGSLYPRPPGSGLAKHPSVSADE
ELSATLARDIVLVSAITLFFFLLALRIPQRLCQRLRIRLPHRYQRLRTED
NT seq 693 nt   +upstreamnt  +downstreamnt
atggagcgtcgccgaggtacggtaccgctgggatgggtgttttttgttctttgcttatct
gcctcttccccgtgtgctgttgatctgggtagcaagtcctccaactcgacctgccgcttg
aatgtgactgagttggcctcgatccatcctggggaaacgtggacgttacacgggatgtgt
atttctatctgctactacgagaatgtgaccgaggacgagataatcggcgtggcttttact
tggcagcataacgagtctgtggttgacctgtggttgtaccagaacgacacggtgatccgc
aatttcagcgacatcaccactaacatcttgcaagacggactgaaaatgcgaaccgtccct
gtgactaaactgtacaccagccgcatggtcactaatcttaccgtgggccgctatgactgt
ttacgctgcgagaacggtacgatgaaaataatcgagcgcctctacgtccgattgggctcg
ctatatccgagaccgcccggatccgggctcgccaaacacccctccgtaagcgccgacgag
gaactgtccgcgaccttggcgagagacatcgtgttggtctcagccatcactctgttcttc
ttcttgttggccctacggatcccccagcgactgtgtcagcggctgcgcattcgcctgccg
catcgataccagcggttacgcaccgaggactga

DBGET integrated database retrieval system