KEGG   Viruses: 3077468
Entry
3077468           CDS       T40000                                 

Gene name
UL33, HHV5wtgp038
Definition
(RefSeq) Human betaherpesvirus 5; envelope glycoprotein UL33
  KO
K22782  Cytomegalovirus G-protein coupled receptor UL33
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: 7tm_1 DUF2664
Other DBs
NCBI-GeneID: 3077468
NCBI-ProteinID: YP_081492
RS: NC_006273
UniProt: Q6SW98 F5HHB2
LinkDB
Position
NC_006273:join(43415..43441,43562..44773)
AA seq 412 aa
MDTIIHNTTNRSTDTPHVNITCNITEPLSAIRTTEAVINTFIIFVGGPLNAIVLITQLLT
NRVLGYSTPTIYMTNLYSTNFLTLTVLPFIVLSNQWLLPASVASCKFLSVIYYSSCTVGF
ATVALIAADRYRVLHKRTYARQSYRSTYIILLLTWFAGLIFSMPAAVYTTVVIHNGTNGQ
SSNGHATCVLYFIADEVYTVLLSWKVLLTLVWGAAPVIMMTWFYAFFYSTVQRASQKQRS
RTLTFVSVLLISFVALQTPYVSIMIFNSYATAAWPMDCEHLTLRRTIGTLSRLVPHLHCL
INPILYALLGHDFLQRMRQCFRGQLLDRRAFLRSQQNQRATAETNLAAGNNSQSVATSLD
TSSKNCNQHAKRSVSFNFPSGTWKGGQKTASNDTSTKIPHRLSQSHHNLSGV
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggacaccatcatccacaacaccacgaaccgcagtaccgatactccgcatgtcaacatc
acctgtaacataacggagccgctatccgccatccgtaccacagaagccgtgatcaacacg
ttcatcattttcgtaggcggcccgctcaatgccatagtgttgatcacgcagctgctcacg
aatcgcgtattgggctattcaacccccaccatctacatgaccaacctctattccaccaac
ttcctcacgctcaccgtactgccatttatcgtgctgagcaaccagtggctactacccgct
agcgtggcttcgtgcaaattcttgtcggtgatttactactcgagctgcacagtaggcttt
gccaccgtagccctgatcgccgccgaccgataccgcgttcttcataagcgtacctacgcg
cggcagtcgtaccgctccacctatataattttgctattgacctggtttgccgggctgatc
ttttccatgcccgcggctgtctacactacagtagtgatacataatggtacaaatggacaa
agtagcaatggacacgctacctgcgtattgtacttcatagccgacgaggtgtacacggta
ctactctcgtggaaagtgctgctgacgctagtgtggggcgccgcgcccgttatcatgatg
acgtggttttacgccttcttctactcaaccgtacagcgtgcgtctcaaaaacaaaggagt
cgcactttaaccttcgtcagcgtgttactcatctccttcgtggcgctacagacgccttac
gtgtccatcatgattttcaacagttacgccacggccgcatggcccatggactgcgaacac
ctgacactgcgacgcaccattggcacgctgtcacgcctggtaccccacctacactgcctc
atcaatcccattctgtacgcgctgctgggtcatgactttctgcagcgcatgcggcagtgt
ttccgcggccagttgctggaccgccgcgctttcctgagatcgcagcagaatcagcgagct
acagcggagacaaatctagcggctggcaacaattcacaatcagttgctacgtcattagac
accagtagcaaaaactgcaatcagcacgccaaacgcagcgtgtctttcaattttcccagc
ggtacgtggaaaggcggccagaaaaccgcgtccaacgacacatccacaaaaatcccccat
cgactctcacaatcgcatcataacctcagcggggtatga

DBGET integrated database retrieval system