KEGG   Viruses: 3077490
Entry
3077490           CDS       T40000                                 

Gene name
US11, HHV5wtgp142
Definition
(RefSeq) Human betaherpesvirus 5; membrane glycoprotein US11
  KO
K22786  HCMV membrane glycoprotein US11
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: CMV_US
Other DBs
NCBI-GeneID: 3077490
NCBI-ProteinID: YP_081596
RS: NC_006273
UniProt: Q6SVZ5 F5HH82
LinkDB
Position
NC_006273:complement(205929..206576)
AA seq 215 aa
MNLVMLILALWAPVAGSMPELSLTLFDEPPPLVETEPLPPLPDVSEYRVEYSEARCVLRS
GGRLEALWTLRGNLSVPTPTPRVYYQTLEGYADRVPTPVEDISESLVAKRYWLRDYRVPQ
RTKLVLFYFSPCHQCQTYYVECEPRCLVPWVPLWSSLEDIERLLFEDRRLMAYYALTIKS
AQYTLMMVAVIQVFWGLYVKGWLHRHFPWMFSDQW
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaatcttgtaatgcttattctagccctctgggccccggtcgcgggtagtatgcctgaa
ttatccttgactcttttcgatgaacctccgcccttggtggagacggagccgttaccgcct
ctgcccgatgtttcggagtaccgagtagagtattccgaggcgcgctgcgtgctccgatcg
ggcggtcgactggaggctctgtggaccctgcgcgggaacctgtccgtgcccacgccgaca
ccccgggtgtactaccagacgctggagggctacgcggatcgagtgccgacgccggtggag
gacatctccgaaagcctcgtcgcaaaacgctactggctccgggactatcgtgttccccaa
cgcacaaaactcgtgttgttctacttttccccctgtcatcaatgccaaacttattatgta
gagtgcgaaccccggtgcctcgtgccttgggttcccctgtggagctcgttagaggacatc
gaacgactattgttcgaagatcgccgtctaatggcgtactacgcgctcacgattaagtcg
gcgcagtatacgctgatgatggtggcagtgattcaagtgttttgggggctgtatgtgaaa
ggttggctgcaccgacattttccctggatgttttcggaccagtggtga

DBGET integrated database retrieval system