KEGG   Viruses: 3077530
Entry
3077530           CDS       T40000                                 

Gene name
UL82, HHV5wtgp076
Definition
(RefSeq) Human betaherpesvirus 5; tegument protein pp71
  KO
K22779  Cytomegalovirus tegument protein pp71
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 3077530
NCBI-ProteinID: YP_081530
RS: NC_006273
UniProt: F5HBC6 C8BL26 V9LLY2
LinkDB
Position
NC_006273:complement(118788..120467)
AA seq 559 aa
MSQASSSPGEGPSSEAAAISEAEAASGSFGRLHCQVLRLITNVEGGSLEAGRLRLLDLRT
NIEVSRPSVLCCFQENKSPHDTVDLTDLNIKGRCVVGEQDRLLVDLNNFGPRRLTPGSEN
NTVSVLAFALPLDRVPVSGLHLFQSQRRGGEENRPRMEARAIIRRTAHHWAVRLTVTPNW
RRRTDSSLEAGQIFVSQFAFRAGAIPLTLVDALEQLACSDPNTYIHKTETDERGQWIMLF
LHHDSPHPPTSVFLHFSVYTHRAEVVARHNPYPHLRRLPDNGFQLLIPKSFTLTRIHPEY
IVQIQNAFETNQTHDTIFFPENIPGVSIEAGPLPDRVRITLRVTLTGDQAVHLEHRQPLG
RIHFFRRGFWTLTPGKPDKIKRPQVQLRAGLFPRSNVMRGAVSEFLPQSPGLPPTEEEEE
EEEEDDEDDLSSTPTPTPLSEAMFAGFEEASGDEDSDTQAGLSRALILTGQRRRSGNNGA
LTLVIPSWHVFASLDDLVPLTVSVQHAALRPTSYLRSDMDGDVRTAADISSTLRSVPAPR
PSPISTASTSSTPRSRPRI
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtctcaggcatcgtcctcgcccggtgagggaccctcgtcggaagcggccgcgatcagc
gaggccgaagccgccagcggaagctttggtcgcctgcactgccaggtgcttcggctcatc
accaacgtggaaggcggctcgctggaagccggtcgtctgcgactcctggacctgcgtacc
aacatagaggtgagccggccctcggttctctgctgttttcaggagaacaaatctccgcac
gacaccgtagacctgaccgacttaaacatcaagggccgctgcgtggtgggcgaacaggac
cgactgctggtggacctcaacaactttggcccacgacgcctgacgccaggctcagaaaac
aacacggtctcggtactggcctttgcgctgccgctggaccgcgtgcccgttagcggactg
cacctctttcagagccagcggcgcggcggcgaagaaaatcggccgcgaatggaagcgcgc
gccatcatccgccgcacggctcaccactgggccgtgcgactgaccgtaacgccgaactgg
cgccgcagaaccgacagcagtttggaggcagggcagatctttgtcagccagttcgccttt
cgcgccggcgccatcccgctgacgctggtagacgccctggagcagctggcctgttcggac
cctaacacgtacatccacaaaacggagacggacgaacgaggccaatggatcatgctgttt
ctgcatcacgactcaccgcacccgccgaccagcgtgtttctgcacttttcggtttacacg
catcgcgccgaggtggtggcgcgacacaatccgtacccgcacctacgacgcttgccggac
aacggcttccagctgttgattcccaaaagttttacgctgacgcgcatacatcccgagtac
atcgtgcagatccagaatgctttcgagaccaatcagactcacgacaccatctttttcccg
gaaaacatcccgggcgtctccatagaagccggcccgctacccgatcgtgtgcgaatcacc
ctccgcgtcacgctgaccggcgatcaggccgttcatttggaacaccgacagccgctaggc
cgcatccactttttccgccgtgggttttggactctcacacccggtaaaccggacaaaatc
aagcgtccccaggtgcagctgcgcgccggtctctttccacggagcaacgtcatgcgcggc
gccgtctccgagtttctcccgcagtcccccggattaccacccaccgaggaagaggaggaa
gaagaggaagaggacgacgaagatgacctctcctccacaccgacgccgacccccctgtcc
gaagccatgtttgccggcttcgaggaagccagcggcgacgaggactcggacacccaagcc
ggactgtcccgggcactgatcctgaccggacaaagacgtcgaagcggtaacaacggggct
ctcacgctcgtcatcccctcgtggcacgtctttgcgagccttgacgacttggtaccatta
acggtgagcgtgcagcacgccgcactacgacctacctcttatctgcgcagcgacatggac
ggcgacgtgcgtaccgcggcagacatcagcagcacgttgcggtccgtgcccgcgccacga
ccctcacccatcagcaccgcttccacttccagcaccccacgcagtcgaccccgcatctag

DBGET integrated database retrieval system